spacer

EBI Dbfetch

ID   U26659; SV 1; linear; genomic DNA; STD; HUM; 262 BP.
XX
AC   U26659;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC Class II HLA DRB1 gene, exon 2, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-262
RA   Brautbar C., Israel S., Safirman C., Smith A.G.;
RT   ;
RL   Submitted (09-MAY-1995) to the INSDC.
RL   Chaim Brautbar, Tissue Typing Laboratory, Hadassah Medical Organization,
RL   Kiryat Hadassah, PO Box 12000, Jerusalem il-91120, Israel
XX
DR   MD5; 4a882acab1f6738a3a1a4b24f57baead.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..262
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            13..>262
FT                   /gene="MHC Class II HLA DRB1"
FT                   /number=2
FT   CDS             <13..>262
FT                   /codon_start=3
FT                   /gene="MHC Class II HLA DRB1"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="AAD09441.1"
FT                   /translation="QPKRECHFFNGTERVRFPDRYFYNQEESVRFDSDVGEYRAVTELG
FT                   RPDAEYWNSQKDILEDRRAAVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 262 BP; 57 A; 65 C; 94 G; 46 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcccgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg ca                                                262
//


spacer
spacer