Dbfetch

ID   U21301; SV 1; linear; mRNA; STD; MUS; 3564 BP.
XX
AC   U21301;
XX
DT   04-JUL-1995 (Rel. 44, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus c-mer tyrosine kinase receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-994
RX   PUBMED; 7784083.
RA   Graham D.K., Bowman G.W., Dawson T.L., Stanford W.L., Earp H.S.,
RA   Snodgrass H.R.;
RT   "Cloning and developmental expression analysis of the murine c-mer tyrosine
RT   kinase";
RL   Oncogene 10(12):2349-2359(1995).
XX
RN   [2]
RP   1-3564
RA   Snodgrass H.R.;
RT   ;
RL   Submitted (17-FEB-1995) to the INSDC.
RL   H.R. Snodgrass, Cancer Research, Univ. of N.C. at Chapel Hill, 235
RL   Lineberger Comp. Cancer Ctr., Chapel Hill, NC 27599-7295, USA
XX
DR   MD5; 1adc6e9fc85ba26e1f72707821a2f41c.
DR   Ensembl-Gn; ENSMUSG00000014361; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026475; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026439; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026414; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026451; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026194; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026896; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025655; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026174; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026308; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026272; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026413; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026292; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026951; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025391; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025729; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000014505; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0057561; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0057594; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0057542; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0057533; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057224; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058005; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0057466; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0057196; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0057293; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0057270; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0057428; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057240; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058171; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057053; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0056524; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3564
FT                   /organism="Mus musculus"
FT                   /strain="B6"
FT                   /mol_type="mRNA"
FT                   /sex="male/female"
FT                   /dev_stage="adult"
FT                   /clone_lib="Lambda Zap, Stratagene cDNA library, catalog
FT                   No. 936308"
FT                   /clone="mcMer 707"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             50..3034
FT                   /codon_start=1
FT                   /product="c-mer tyrosine kinase receptor"
FT                   /note="similar to the human c-mer proto-oncogene product
FT                   encoded by GenBank Accession Number U08023"
FT                   /db_xref="GOA:Q60805"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:96965"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60805"
FT                   /protein_id="AAA80222.1"
FT                   /translation="MVLAPLLLGLLLLPALWSGGTAEKWEETELDQLFSGPLPGRLPVN
FT                   HRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKN
FT                   VKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRS
FT                   DNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPV
FT                   NIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSP
FT                   PTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYE
FT                   IQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIR
FT                   WTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAA
FT                   ITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMFIILGCFCGFILIGLILCIS
FT                   LALRRRVQETKFGGAFSEEDSQLVVNYRAKKSFCRRAIELTLQSLGVSEELQNKLEDVV
FT                   IDRNLLVLGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIEEFLSEAAC
FT                   MKDFNHPNVIRLLGVCIELSSQGIPKPMVILPFMKYGDLHTFLLYSRLNTGPKYIHLQT
FT                   LLKFMMDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGR
FT                   IAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEITTRGMTPYPGVQNHEMYDYLLHGH
FT                   RLKQPEDCLDELYDIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESIIYINTQ
FT                   LLESCEGIANGPSLTGLDMNIDPDSIIASCTPGAAVSVVTAEVHENNLREERYILNGGN
FT                   EEWEDVSSTPFAAVTPEKDGVLPEDRLTKNGVSWSHHSTLPLGSPSPDELLFVDDSLED
FT                   SEVLM"
FT   sig_peptide     50..109
FT   misc_feature    313..583
FT                   /note="encodes immunoglobulin-like 1 domain similarity"
FT   misc_feature    626..844
FT                   /note="encodes immunoglobulin-like 1 domain similarity"
FT   misc_feature    884..1168
FT                   /note="encodes fibronectin-like 1 similarity"
FT   misc_feature    1184..1513
FT                   /note="encodes fibronectin-like 1 similarity"
FT   misc_feature    1538..1619
FT                   /note="encodes a transmembrane region"
FT   misc_feature    1793..2551
FT                   /note="encodes a tyrosine kinase domain"
XX
SQ   Sequence 3564 BP; 957 A; 888 C; 879 G; 840 T; 0 other;
     tggatacgtg catctgtccg gagagaactg ccagatccgc ggccccgcga tggttctggc        60
     cccactgcta ctggggctgc tgctgctacc cgcgctctgg agtggaggca ctgccgagaa       120
     gtgggaagag accgagctag atcagctatt ttcagggcct ttaccaggga gactcccagt       180
     caaccacagg ccattctctg ctcctcactc cagccgggac cagctgccac caccccagac       240
     tggaagatca catccagcac acacagccgc tccccaggtg acctccacag catcaaagct       300
     cctacctcct gttgcgttta atcacaccat tggacacata gtactgtcgg aacataaaaa       360
     tgtcaaattt aattgctcca tcaatattcc taacacatac caagaaacag ctggcatttc       420
     atggtggaaa gatggaaagg aattgctcgg ggcacatcat tcaatcacac agttttatcc       480
     tgatgaggaa ggggtatcaa taattgcatt gttcagcata gccagtgtgc agcgctcaga       540
     caatgggtcg tacttctgta agatgaaggt gaacaataga gagattgtat ctgatcccat       600
     atacgtggaa gttcaaggac tcccttactt tattaagcag cctgagagtg tgaatgtcac       660
     cagaaacaca gccttcaacc tcacctgcca ggccgtgggc cctcctgagc ccgtcaatat       720
     cttctgggtt caaaatagca gccgtgttaa tgaaaaaccg gaaaggtccc cgtctgtcct       780
     aaccgtacct ggtctgacag agacagcagt cttcagctgt gaggcccaca atgacaaagg       840
     actgacggtg tccaagggtg tacatatcaa catcaaagta atcccctccc cgcccactga       900
     agtccatatc ctcaacagta cagcacacag catcctggtc tcctgggtcc ctggttttga       960
     tggctactcc ccacttcaga actgcagcat tcaggtcaag gaagctgacc ggctgagtaa      1020
     tggctcagtc atggttttta atacctctgc ttcgccacat ctgtatgaga tccagcagct      1080
     gcaagccctg gctaattaca gcatcgctgt gtcctgtcgg aatgagattg gctggtctgc      1140
     agtaagccct tggattctgg ccagcacaac agaaggagct ccatctgtag cacctttaaa      1200
     catcactgtg tttctgaacg aatctaacaa tatcctggat attagatgga cgaagcctcc      1260
     aattaagcgg caggatgggg aactggtggg ctaccggata tctcacgtgt gggaaagcgc      1320
     agggacttac aaagagcttt ctgaagaagt cagccagaat ggcagctggg ctcagattcc      1380
     tgtccaaatc cacaatgcca cctgcacagt gagaatcgcg gccattacta aagggggcat      1440
     cgggcccttc agtgagccag tgaatatcat cattcctgaa cacagtaagg tagattacgc      1500
     accctcgtca accccagccc ctggcaacac cgactctatg ttcatcatcc tcggctgctt      1560
     ctgtggattc attttaatcg ggttaatttt gtgtatttct ctggccctca gaaggagagt      1620
     ccaggaaaca aagtttgggg gagcattctc tgaggaggat tcccaactgg tcgtaaatta      1680
     tagagcgaag aagtccttct gccggcgagc catcgagctt accttgcaga gcctgggagt      1740
     gagcgaggag ctgcagaata agctggaaga tgttgtgatt gacagaaacc ttctggttct      1800
     cggcaaagtt ctgggtgaag gagagtttgg gtctgtaatg gaaggaaatt tgaagcaaga      1860
     agatgggact tctcagaagg tggcagtgaa gaccatgaag ttggacaact tttctcaacg      1920
     ggagatcgag gagtttctca gcgaagcagc atgcatgaaa gacttcaacc acccaaatgt      1980
     catccgactt ctaggcgtgt gtatagaact gagctctcaa ggcatcccga agcccatggt      2040
     gattttaccc ttcatgaaat acggagacct ccacaccttc ctgttatatt cccgattaaa      2100
     cacaggaccc aagtacattc acctgcagac actactgaag ttcatgatgg acattgccca      2160
     gggaatggag tatctgagca acaggaattt tcttcatagg gatttggcag ctcgaaactg      2220
     catgttgcgg gatgacatga ctgtctgcgt ggcagacttt ggcctctcaa agaagattta      2280
     cagtggtgat tattaccgcc aaggccgcat tgccaaaatg cctgtgaagt ggatcgccat      2340
     cgagagcctg gcggaccgag tctacacaag caaaagtgac gtgtgggctt ttggcgtgac      2400
     catgtgggaa ataacaacac ggggaatgac tccctatccc ggagttcaga accatgagat      2460
     gtacgactac cttctccacg gccacaggct gaagcagcct gaggactgct tggatgaact      2520
     gtatgacatc atgtactctt gctggagtgc tgatcccttg gatcgaccca ccttctctgt      2580
     gttgaggctg cagctggaaa agctctccga gagtttgcct gatgcgcagg acaaagaatc      2640
     catcatctac atcaataccc agttgctaga gagctgcgag ggcatagcca atgggccctc      2700
     actcacgggg ctagacatga acattgaccc tgactccatc attgcctctt gcacaccagg      2760
     cgctgccgtc agcgtggtca cggcagaagt tcacgagaac aaccttcgtg aggaaagata      2820
     catcttgaat gggggcaatg aggaatggga agatgtgtcc tccactcctt ttgctgcagt      2880
     cacacctgaa aaggatggtg tcttaccgga ggacagactc accaaaaatg gcgtctcctg      2940
     gtctcaccat agtacactac ccttggggag cccatcacca gatgaacttt tatttgtaga      3000
     tgactccttg gaagactctg aagttctgat gtgaagccag ctgagaggag gcatgagaga      3060
     accaagcaaa tacagcttcc tgggatctgg tggtcttaga tactttgtta ttgctctgat      3120
     aaaacatcat gaccaaggca atcttcaaga gaaagtgttt aactaggttt actgtttcag      3180
     ggggttagag tctatgattg cagaaggaag ttatgatggc aggaacagct gagtgcttat      3240
     atctttaaga gcaagcagga gacagagagc actctgggaa atggcaccta tcttttgaaa      3300
     cctcaaagcc tgctcccagt gacaaaagtc cttcaacagg ccatacctcc taatccttcc      3360
     caaacaattc caccaactgg agaccaaaca ttcaaatgta tgcgcgtatt ggggccattc      3420
     ttaagcaaac cactacactg gttatacctg aggttttggt acttgttttc cttaccaagt      3480
     agagttcatg gccggacagc accaggtgaa agctgtcaag tcaggtttgc aaatacataa      3540
     ccaaggtctt gagagctcgt gccg                                             3564
//