Dbfetch

ID   AH005408; SV 3; linear; mRNA; STD; MUS; 2256 BP.
XX
AC   AH005408; U20225-U20226;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus adenylosuccinate lyase (adl) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2256
RX   DOI; 10.1006/geno.1995.1152.
RX   PUBMED; 8530047.
RA   Wong L.J., O'Brien W.E.;
RT   "Characterization of the cDNA and the gene encoding murine adenylosuccinate
RT   lyase";
RL   Genomics 28(2):341-343(1995).
XX
RN   [2]
RP   1-2256
RA   Wong L.C.;
RT   ;
RL   Submitted (24-JAN-1995) to the INSDC.
RL   Lee-Jun C. Wong, Molecular and Human Genetics, Baylor College of Medicine,
RL   One Baylor Plaza, Houston, TX 77030, USA
XX
DR   MD5; 42535a741e26a204cda3aa7310c237e6.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:717124,
CC   gi:717125, gi:22450713.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2256
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   source          1..283
FT                   /organism="Mus musculus"
FT                   /strain="129"
FT                   /mol_type="mRNA"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   source          384..2256
FT                   /organism="Mus musculus"
FT                   /strain="129"
FT                   /mol_type="mRNA"
FT                   /clone="madlcDNA"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   gene            1..2256
FT                   /gene="adl"
FT   5'UTR           1..>283
FT                   /gene="adl"
FT   gap             284..383
FT                   /estimated_length=unknown
FT   exon            <384..570
FT                   /gene="adl"
FT   5'UTR           <384..417
FT                   /gene="adl"
FT   CDS             418..1872
FT                   /codon_start=1
FT                   /gene="adl"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="MADL"
FT                   /protein_id="AAB60684.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDSVMDLQNLKRVRDDVRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
FT   exon            571..774
FT                   /gene="adl"
FT   exon            775..819
FT                   /gene="adl"
FT   exon            820..899
FT                   /gene="adl"
FT   exon            900..1071
FT                   /gene="adl"
FT   exon            1072..1118
FT                   /gene="adl"
FT   exon            1119..1209
FT                   /gene="adl"
FT   exon            1210..1279
FT                   /gene="adl"
FT   exon            1280..1427
FT                   /gene="adl"
FT   exon            1428..1518
FT                   /gene="adl"
FT   exon            1519..1608
FT                   /gene="adl"
FT   exon            1609..1785
FT                   /gene="adl"
FT   exon            1786..2251
FT                   /gene="adl"
FT   3'UTR           1873..2256
FT                   /gene="adl"
FT   regulatory      2231..2236
FT                   /gene="adl"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2256 BP; 538 A; 565 C; 593 G; 460 T; 100 other;
     tactccaagt gtccactagg ggcttcctgg cgtcctccga atgcctctgc aactttcctt        60
     tctgggttaa acgcgggtct taatgtgcct tcctcagatg gaaaaactga ggaggcacag       120
     cgtggggcag agattcgtaa gaaaccaaga gaaaagcgtt gacctcaggg gcgacgagcc       180
     aaacttgaac catcttcgct tccaggccgg cgttacacac gggcggggcc ttgggaggaa       240
     gtcccgcccc acgcacgcca cccttccgct tttggccctg ctgnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnctggtgt ccgccgcgtc ctggtcgcgt gttgaaaatg       420
     gctgcatccg gcgaccctgg cagtgctgaa agttaccgtt ctccgctggc ggcccgctac       480
     gccagccgcg agatgtgttt cttgttcagc gacaggtaca agttccagac gtggcggcag       540
     ctgtggctgt ggctggcgga ggccgaacag acgctgggtt tgcctatcac agatgaacaa       600
     atccaggaga tgaagtcgaa cctgaacaac attgacttcc agatggcagc tgaggaagag       660
     aagcgcttgc ggcacgacgt gatggctcac gtgcacacgt ttggccactg ctgtccgaaa       720
     gctgcgggca ttattcatct gggcgccacc tcctgctatg tcggagacaa tacggacctg       780
     attattctga gaaatgcatt tgacctactt ttgccaaagc ttgcaagagt gatctcgagg       840
     cttgccgact ttgctaagga tcgtgctgat ctgcccacgt taggtttcac acactttcag       900
     cctgctcagc tgaccacggt tgggaaacga tgctgccttt ggattcaaga ctctgtcatg       960
     gatctccaga acttgaagcg tgtccgggat gacgtgcgct tccgaggagt aaagggcacc      1020
     actggcacgc aggccagctt cctgcagctc ttcgaggggg atcaccagaa ggtggagcag      1080
     ctggacaaga tggtgacaga aaaggcaggg tttaaaagag ccttcatcat cacaggacag      1140
     acgtacacac ggaaagtgga catcgaagtg ctgtctgtgc tggccagctt aggagcatcg      1200
     gtgcacaaga tttgcactga catacgcctg ctggcaaacc tgaaggagat ggaggagccc      1260
     tttgagaaac agcagattgg ctccagtgcg atgccgtaca agcggaaccc catgcgctcc      1320
     gaacgttgct gcagcctggc ccgtcacctg atggccctta ccatggaccc actacagaca      1380
     gcgtctgtgc agtggtttga acgtactctg gatgacagtg ccaaccgacg gatctgtttg      1440
     gctgaagcgt ttctcactgc agatactata ttaaacaccc tacagaacat ttctgaagga      1500
     ttggtggtgt accccaaagt aattgaacgg cgcattcggc aagagctgcc tttcatggcc      1560
     acagagaaca tcatcatggc aatggtgaaa gccgggggca gccgacagga ctgccatgag      1620
     aaaattagag tgctttccca gcaggcagct gctgtggtca agcaggaagg aggtgacaat      1680
     gaccttatag agcgcatccg ggcagatgcc tacttcagcc ccatccactc acagctggag      1740
     cacttgctgg acccctcttc tttcactggc cgagcacccc agcaggtcca cagattcctg      1800
     gaagaggaag tgcgccccct gctaaagccc tatgggaatg agatggcggt gaaagcagag      1860
     ctgtgtctgt agagtaggag agctgaggag aacccggtta cagtgattag agctttgctg      1920
     attacagtgt tagagttact actgtgttct gcggcactcc tttacacact caggaggcag      1980
     aggcaggcag atctctgagt tcaaggccag cctggtctac aaaacaagtt ccaggacagc      2040
     cagagctaca cagagaaacc ctgtctcaac aaacaaacaa acagaggctg gggacatggc      2100
     actgactgct cttccaaagg tcctgagttc aaatcccagc aaccacatgg tggctcacaa      2160
     ccatctgtaa tgagatctga tgccctcttc tggtgcaatg aagacagcta cagtgtattc      2220
     atatacataa aataaatgaa tctttaaaaa caaaaa                                2256
//