spacer

EBI Dbfetch

ID   U20225; SV 1; linear; mRNA; STD; MUS; 1873 BP.
XX
AC   U20225;
XX
DT   31-MAR-1995 (Rel. 43, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus adenylosuccinate lyase (adl) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1873
RX   DOI; 10.1006/geno.1995.1152.
RX   PUBMED; 8530047.
RA   Wong L.J., O'Brien W.E.;
RT   "Characterization of the cDNA and the gene encoding murine adenylosuccinate
RT   lyase";
RL   Genomics 28(2):341-343(1995).
XX
RN   [2]
RP   1-1873
RA   Wong L.C.;
RT   ;
RL   Submitted (24-JAN-1995) to the INSDC.
RL   Lee-Jun C. Wong, Molecular and Human Genetics, Baylor College of Medicine,
RL   One Baylor Plaza, Houston, TX 77030, USA
XX
DR   MD5; d987caccc5ea07fd09759ef433fdda31.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
DR   EuropePMC; PMC87143; 11416145.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1873
FT                   /organism="Mus musculus"
FT                   /strain="129"
FT                   /mol_type="mRNA"
FT                   /clone="madlcDNA"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   exon            <1..187
FT                   /gene="adl"
FT   5'UTR           <1..34
FT                   /gene="adl"
FT   CDS             35..1489
FT                   /codon_start=1
FT                   /gene="adl"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="MADL"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /protein_id="AAB60684.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDSVMDLQNLKRVRDDVRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
FT   exon            188..391
FT                   /gene="adl"
FT   exon            392..436
FT                   /gene="adl"
FT   exon            437..516
FT                   /gene="adl"
FT   exon            517..688
FT                   /gene="adl"
FT   exon            689..735
FT                   /gene="adl"
FT   exon            736..826
FT                   /gene="adl"
FT   exon            827..896
FT                   /gene="adl"
FT   exon            897..1044
FT                   /gene="adl"
FT   exon            1045..1135
FT                   /gene="adl"
FT   exon            1136..1225
FT                   /gene="adl"
FT   exon            1226..1402
FT                   /gene="adl"
FT   exon            1403..1868
FT   3'UTR           1490..1873
FT   polyA_signal    1848..1853
XX
SQ   Sequence 1873 BP; 478 A; 480 C; 514 G; 401 T; 0 other;
     ctggtgtccg ccgcgtcctg gtcgcgtgtt gaaaatggct gcatccggcg accctggcag        60
     tgctgaaagt taccgttctc cgctggcggc ccgctacgcc agccgcgaga tgtgtttctt       120
     gttcagcgac aggtacaagt tccagacgtg gcggcagctg tggctgtggc tggcggaggc       180
     cgaacagacg ctgggtttgc ctatcacaga tgaacaaatc caggagatga agtcgaacct       240
     gaacaacatt gacttccaga tggcagctga ggaagagaag cgcttgcggc acgacgtgat       300
     ggctcacgtg cacacgtttg gccactgctg tccgaaagct gcgggcatta ttcatctggg       360
     cgccacctcc tgctatgtcg gagacaatac ggacctgatt attctgagaa atgcatttga       420
     cctacttttg ccaaagcttg caagagtgat ctcgaggctt gccgactttg ctaaggatcg       480
     tgctgatctg cccacgttag gtttcacaca ctttcagcct gctcagctga ccacggttgg       540
     gaaacgatgc tgcctttgga ttcaagactc tgtcatggat ctccagaact tgaagcgtgt       600
     ccgggatgac gtgcgcttcc gaggagtaaa gggcaccact ggcacgcagg ccagcttcct       660
     gcagctcttc gagggggatc accagaaggt ggagcagctg gacaagatgg tgacagaaaa       720
     ggcagggttt aaaagagcct tcatcatcac aggacagacg tacacacgga aagtggacat       780
     cgaagtgctg tctgtgctgg ccagcttagg agcatcggtg cacaagattt gcactgacat       840
     acgcctgctg gcaaacctga aggagatgga ggagcccttt gagaaacagc agattggctc       900
     cagtgcgatg ccgtacaagc ggaaccccat gcgctccgaa cgttgctgca gcctggcccg       960
     tcacctgatg gcccttacca tggacccact acagacagcg tctgtgcagt ggtttgaacg      1020
     tactctggat gacagtgcca accgacggat ctgtttggct gaagcgtttc tcactgcaga      1080
     tactatatta aacaccctac agaacatttc tgaaggattg gtggtgtacc ccaaagtaat      1140
     tgaacggcgc attcggcaag agctgccttt catggccaca gagaacatca tcatggcaat      1200
     ggtgaaagcc gggggcagcc gacaggactg ccatgagaaa attagagtgc tttcccagca      1260
     ggcagctgct gtggtcaagc aggaaggagg tgacaatgac cttatagagc gcatccgggc      1320
     agatgcctac ttcagcccca tccactcaca gctggagcac ttgctggacc cctcttcttt      1380
     cactggccga gcaccccagc aggtccacag attcctggaa gaggaagtgc gccccctgct      1440
     aaagccctat gggaatgaga tggcggtgaa agcagagctg tgtctgtaga gtaggagagc      1500
     tgaggagaac ccggttacag tgattagagc tttgctgatt acagtgttag agttactact      1560
     gtgttctgcg gcactccttt acacactcag gaggcagagg caggcagatc tctgagttca      1620
     aggccagcct ggtctacaaa acaagttcca ggacagccag agctacacag agaaaccctg      1680
     tctcaacaaa caaacaaaca gaggctgggg acatggcact gactgctctt ccaaaggtcc      1740
     tgagttcaaa tcccagcaac cacatggtgg ctcacaacca tctgtaatga gatctgatgc      1800
     cctcttctgg tgcaatgaag acagctacag tgtattcata tacataaaat aaatgaatct      1860
     ttaaaaacaa aaa                                                         1873
//


spacer
spacer