spacer

EBI Dbfetch

ID   U17869; SV 1; linear; mRNA; STD; MUS; 7582 BP.
XX
AC   U17869;
XX
DT   21-MAR-1995 (Rel. 43, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus murine erythroleukemia cardiac calcium channel (MELC-CC) mRNA,
DE    complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7582
RA   Marks A.R.;
RT   "Cloning and expression of a novel truncated calcium channel from
RT   non-excitable cells";
RL   J Biol Chem 0:0-0(1995).
XX
RN   [2]
RP   1-7582
RA   Marks A.R.;
RT   ;
RL   Submitted (30-NOV-1994) to the INSDC.
RL   Andrew R Marks, Brookdale Center for Molecular Biology, Mount Sinai School
RL   of Medicine, One Gustave L. Levy Place, New York, NY 10029, USA
XX
DR   MD5; ab22f0a3d8585b2a763fce77dfbb9efd.
DR   Ensembl-Gn; ENSMUSG00000051331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112825; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7582
FT                   /organism="Mus musculus"
FT                   /strain="DBA/2"
FT                   /mol_type="mRNA"
FT                   /clone="MELC-CC"
FT                   /cell_line="C29"
FT                   /cell_type="erythroleukemia cells"
FT                   /db_xref="taxon:10090"
FT   CDS             395..6004
FT                   /codon_start=1
FT                   /product="murine erythroleukemia cardiac calcium channel"
FT                   /note="MELC-CC; this product was determined to be truncated
FT                   in its 5' end by comparison to the rabbit form: product
FT                   encoded by GenBank Accession Number X15539"
FT                   /db_xref="GOA:Q01815"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005446"
FT                   /db_xref="InterPro:IPR005451"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014873"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="MGI:MGI:103013"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01815"
FT                   /protein_id="AAA62612.1"
FT                   /translation="MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPA
FT                   KEDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDV
FT                   LYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREK
FT                   QQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNRGAPAGLHDQKKGKFAWFSHSTE
FT                   THVSMPTSETESVNTDNVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAA
FT                   VKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEDQDTANKALLALFTAEMLLKMYSLG
FT                   LQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLS
FT                   NLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLL
FT                   TVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNL
FT                   ADAESLTSAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEESKEEKIELKSITGSGES
FT                   PPTTKIHMDALQPSEPEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPM
FT                   PEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHMT
FT                   AYGAFLHKGSFCRNYFNILDLLVLCVSLISFGIQSSAINVVKILRVLRVLRPLRAINRA
FT                   KGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQAEAECKG
FT                   NYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTE
FT                   DKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQC
FT                   VEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFK
FT                   IAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNSAE
FT                   ENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVI
FT                   GMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESE
FT                   PSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLD
FT                   EFKRIWAEYDPKAKGRIKHLDVVTLLRRIHPPLGFGKLCPHRVACKRLVSMNMPLNSDG
FT                   TVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEV
FT                   TVGKFYATFLIQEYFRKFKERKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGD
FT                   LTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVTYYQSDSRGNFPQTFATQRPLHIN
FT                   KTGNNQADTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPHPAGYSSTVST
FT                   VEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQGATVNQEIFPDETRSVRMSEEAEYCSE
FT                   PSLLSTDMFSYQEDEHRQLTCPEEDKREIQPSPKRSFLRSASLGRRASFHLECLKRQKD
FT                   QGGDISQKTALPLHLVHHQALAVAGLSPLLQRSHSPTTFPRPCPTPPVTPASRGSTLRP
FT                   IPHLRLKGAESSEKLNSSFPSIHCSSWSEETTACSGSSSMARRARPVSLTVPSQAGAPG
FT                   RQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGG
FT                   RQQSPNGTLLPLVNCRDPGQDRAVVPEDESCAYALGRGRSEEALADSRSYVSNL"
XX
SQ   Sequence 7582 BP; 1792 A; 2031 C; 1966 G; 1793 T; 0 other;
     ggtaatccac cacggagaag cctgagatga ctaagtcctc tgtggccgtg ggtagtcaca        60
     gtgagttctc gtgctgagct ctgctctgga aggagacaca ctagggtgtc tctgagatgg       120
     gctatttaaa aatcttaata gttacggatg aaaacaacaa catgttctcc ccctccgaag       180
     cacagctctg ctgccgatcc ttttatttgg atgtgcctcc aggagagatt tggagtcaag       240
     ccaacccgaa cttagattct agccctgtca ctcattggct gtgaccttga gcctcttttt       300
     gctcatctaa agcctgggac tagggactcc cacttgagct gctaagaaga ctgcaggagg       360
     tctccaggtg gtcctgaact ccatcatcaa ggccatggtg cctctgctgc acattgccct       420
     tcttgtgctc ttcgtcatca tcatttatgc tattatcggc ctggagctct tcatgggaaa       480
     gatgcacaag acctgctaca accaggaggg cataatagat gttccggcaa aagaggatcc       540
     ttccccttgt gctttggaga caggccatgg gcgacagtgt cagaacggga ccgtgtgcaa       600
     acccgggtgg gatgggccca agcacggcat caccaacttc gacaacttcg ccttcgccat       660
     gctgacggtg ttccagtgta tcaccatgga gggctggaca gacgtgctgt actgggtcaa       720
     tgatgccgta ggaagggact ggccctggat ctattttgta acactaatca tcatagggtc       780
     attttttgta cttaacttgg ttctcggtgt tcttagcggg gagttttcca aagagaggga       840
     gaaagccaaa gcccgaggag atttccagaa gcttcgagag aagcagcaac tagaagaaga       900
     tctcaaaggc tacctggact ggatcaccca ggcagaagac attgaccccg agaacgaaga       960
     cgagggcatg gatgaagaca agcctcgaaa cagaggcgct ccagcgggct tgcatgatca      1020
     gaagaaaggg aagtttgctt ggtttagtca ctctacagaa acccatgtga gcatgcccac      1080
     aagtgagact gagtctgtca acactgacaa cgtggctgga ggtgacatcg agggagaaaa      1140
     ctgtggagcc aggcttgccc atcggatctc caaatccaaa ttcagccgct actggcgcag      1200
     gtggaatcga ttctgcagaa gaaaatgccg tgcagcagtt aagtccaacg tcttctactg      1260
     gctcgtgatc ttcctggtgt tcctcaacac cctcaccatt gcctccgaac attacaacca      1320
     gcctcactgg ctcacagaag accaagacac agccaataaa gccctcctgg cccttttcac      1380
     tgcagaaatg ctcctgaaga tgtacagcct gggtctgcag gcctattttg tgtccctctt      1440
     caaccgcttt gactgtttca ttgtgtgtgg gggcatcctg gagaccatcc tggtggagac      1500
     gaagatcatg tctcccctgg gcatctctgt gctgagatgt gtgcggttgc tcaggatctt      1560
     caagatcacc aggtactgga attccttgag caaccttgtg gcatccttgc tgaactcagt      1620
     gcgctccatt gcctccctgc tgctgctcct cttcctcttc atcatcatct tctccctcct      1680
     ggggatgcag ctctttggag ggaagttcaa tttcgatgag atgcagaccc gtaggagcac      1740
     gttcgataac ttcccgcagt ctctcctcac tgtgtttcag atcctgaccg gggaggactg      1800
     gaattcggtg atgtatgatg ggatcatggc ttatggcggc ccctcttttc cagggatgtt      1860
     agtctgtatt tacttcatca tcctcttcat ctgtggaaat tatatcctac tgaatgtgtt      1920
     cttggccatt gcggtggaca acctggctga tgcggagagc ctgacctcag cccaaaagga      1980
     ggaggaagaa gagaaggaga ggaagaagct ggccaggact gccagcccag aaaagaaaca      2040
     ggaggtgatg gagaagccag ccgtggagga gagcaaagag gagaaaattg aactgaaatc      2100
     cattacaggc agtggagaat ccccacccac taccaagata cacatggatg cactccagcc      2160
     cagtgaaccc gaggataaga gtccccactc caacccagac actgcagggg aagaggatga      2220
     agaggagcca gagatgcctg tggggccacg cccccggccc ctgtctgagc tgcaccttaa      2280
     ggaaaaggca gttcccatgc cggaagccag tgcatttttc atcttcagcc caaacaacag      2340
     gttccgcctg cagtgccacc gtattgtcaa tgacacgatc ttcaccaacc tcatcctctt      2400
     cttcattctg ctcagcagca tctctctggc tgctgaggac cccgtccagc acacctcctt      2460
     caggaaccat atgactgctt acggggcttt cctgcacaag ggctctttct gccgaaacta      2520
     cttcaatatc ctggacctgc tggtgttgtg cgtgtccctc atctcctttg gcatccagtc      2580
     cagcgcgatc aacgttgtga agattttacg agtgctgcga gtcctcagac ccctgagggc      2640
     catcaacagg gccaaggggc taaagcatgt ggttcagtgc gtgtttgtgg ccatccggac      2700
     catcgggaac atcgtaattg tcaccactct gctgcagttc atgttcgcct gcattggggt      2760
     ccagctcttc aagggaaagc tctatacctg ttcggatagt tctaaacagg cggaggcaga      2820
     atgcaagggt aactatatca catacaaaga tggagaggtc gatcacccca ttatccagcc      2880
     tcgaagctgg gagaacagca agtttgactt tgacaatgtt ttggcagcca tgatggctct      2940
     cttcaccgtc tccaccttcg aagggtggcc agagctgctg taccgctcca ttgactccca      3000
     cacagaagac aagggcccca tctacaacta ccgtgtggag atctccatct tcttcatcat      3060
     ctatatcatc atcattgcct tcttcatgat gaacatcttc gtgggtttcg tcattgtcac      3120
     cttccaggag cagggggaac aagagtacaa gaactgtgag ctggacaaga accagagaca      3180
     atgtgtggaa tatgccctca aggcccgacc cttgcgaagg tacatcccca agaaccagca      3240
     ccagtacaaa gtgtggtacg tggtcaactc tacctacttc gagtatctga tgttcgttct      3300
     catcctgctc aacaccatct gcctggccat gcagcactat ggccagagct gcctcttcaa      3360
     aatcgccatg aatatactca acatgctttt caccggcctc ttcacagtgg agatgatcct      3420
     gaagctcatt gccttcaaac ccaagggtta ctttagtgat ccctggaatg tttttgactt      3480
     cctcatcgtc attgggagca taattgatgt cattctcagt gagactaata gtgcagagga      3540
     gaactcccgc atctccatca ctttcttccg cctcttccgg gtcatgcgcc tggtgaagct      3600
     gctgagccgc ggggaaggca tccgaaccct gctgtggacc ttcatcaagt ccttccaggc      3660
     tctgccctat gtggctcttt tgattgtgat gctgttcttt atctatgcag tgattgggat      3720
     gcaggtgttt gggaagattg ccctgaatga caccacagag atcaatcgga acaacaactt      3780
     ccagacgttc ccccaggctg tgttactgct gttcaggtgt gccaccggag aggcctggca      3840
     ggacatcatg ctggcctgca tgccaggcaa gaagtgtgcc ccagagtctg agcccagcaa      3900
     cagcacggaa ggggagaccc cctgtggcag cagctttgct gtcttctact tcatcagctt      3960
     ctacatgctc tgtgccttcc tgatcatcaa cctctttgta gctgttatca tggacaactt      4020
     tgactacctg actagggatt ggtctatcct cggtccccat cacctggatg aattcaagag      4080
     aatctgggcc gagtatgacc ctaaagccaa gggtcggatc aaacacttgg atgtggtgac      4140
     cctcctccgt cgaattcatc ccccactggg ttttgggaaa ttgtgtcctc accgtgtggc      4200
     ctgcaaacga ctggtgtcca tgaacatgcc tctgaacagc gatggcacag tcatgttcaa      4260
     tgctaccctg tttgccctcg tcaggacagc cctgaggatc aaaacagaag ggaacctaga      4320
     gcaagccaat gaggagcttc gggccatcat caagaaaatc tggaagagga ctagcatgaa      4380
     gctgttggac caggtggtgc cccctgcagg cgatgacgag gtcacagtgg gcaagttcta      4440
     tgccaccttc ctgatccaag agtacttcag gaaattcaaa gagcgaaaag agcaggggct      4500
     ggtgggcaag ccctcacaaa ggaatgcact gtccctccag gctggcttgc gcaccttgca      4560
     tgacattggg cctgagatcc ggcgggccat ctctggggat ctgactgctg aggaggagtt      4620
     ggacaaggct atgaaggagg cggtgtctgc tgcctccgaa gatgacatct tcaggagggc      4680
     tggaggcctg ttcggcaacc atgtcaccta ctatcagagt gacagcaggg gcaactttcc      4740
     tcagacgttc gccacccagc gcccactgca catcaacaag acagggaaca accaagctga      4800
     cactgagtca ccgtcccatg agaagctggt ggactccacg ttcaccccca gcagctactc      4860
     atccacgggc tccaatgcca acatcaacaa tgccaacaac actgccctgg gccgcttccc      4920
     ccatcccgct ggctactcca gcacggtcag cactgtggag ggccatgggc ctcccttgtc      4980
     ccctgctgtc cgagtacagg aggcagcatg gaagctcagc tctaagaggt gccactcccg      5040
     agagagccag ggagccacgg tgaatcagga gatatttcca gatgagaccc gcagcgtaag      5100
     gatgagtgaa gaagccgagt actgcagtga gcccagcctg ctctccacag atatgttctc      5160
     ctaccaggaa gatgaacacc gacaactgac ctgcccagag gaggacaaga gggagatcca      5220
     gccatctcca aagaggagtt tccttcgctc tgcctctcta ggtcgaaggg cctccttcca      5280
     tctggaatgt ctaaagcgac aaaaggatca agggggagac atctctcaga agacagcctt      5340
     gcccttgcat ctggttcatc atcaggcatt ggcagtggca ggcttgagcc ccctcctgca      5400
     gagaagccat tctcctacca cattccccag gccgtgcccc acaccccctg tcactccagc      5460
     cagccggggc agcaccctac ggcccatccc tcacctacgg ctgaaggggg cagagtccag      5520
     cgagaaactc aacagcagct tcccatccat ccactgcagc tcctggtctg aggagacgac      5580
     agcctgtagt gggagcagca gcatggcccg gagagcccgg cccgtctccc tcaccgtgcc      5640
     cagccaggct ggagctccag ggagacagtt ccatggcagt gccagcagcc tggtggaagc      5700
     ggtcttgatt tcagaaggac tgggacagtt tgctcaagat cccaagttca tcgaggtcac      5760
     cacccaggag ctggctgacg cctgcgacat gacaatagag gagatggaga acgccgcaga      5820
     caacatcctc agtgggggcc gccagcagag ccccaacggc accctcttac ctttggtgaa      5880
     ctgtagggac ccggggcagg acagggctgt ggtcccagag gacgagagct gcgcatatgc      5940
     cctggggcga ggccggagcg aggaggcgct cgcggacagc aggtcctacg tcagcaacct      6000
     gtagtcctca gggctggcga gacgcgggtg gtttttttat tcgtttcaat gttcctaatg      6060
     ggttcgtttc agaagtgcct cactgttctc gtgacctgga ggtaaccgga acacggtctt      6120
     cattcactgc tgtcgggata agcctcagag ctgggcggtg tacggagtcg gcttttcagg      6180
     ggagaaggcc aagaccgtgg tgcgggggct ccagcacctt cccgcggcag caccgcccca      6240
     aggaccgcca cccccacccc tgagcaaaag ggtgttttcc ccttgcttgt ataaacagtc      6300
     atttgcacat gttctgtctg agcctggccg tctctatgga gcaggccccc agggatctat      6360
     ggcaggaatg ggccagcgcc cccagtagga gccgggaggt ggctgcgagg ttcccagcag      6420
     tgcaggtctg gtccctatgg tcccttcagg gactctttcc ctgcaaggag ctgagatgca      6480
     ggtggcagga gccagtgcag atcacaccac ccgccctcag ctagccaggc caggggggcg      6540
     gcaggctgct gcctggtgct cggggtttca tggttttgag ggttcttgtc agcatgttgc      6600
     gactttctgg ggtttggttt ctttattact atttgttgtg ttttcccacg gggaggggag      6660
     gaataagagc ggttacaact gcgcggcctc acttcactgt ttccacattt gcatttgcgt      6720
     atttaagtcg gatttgttat gattgtattc tttaaatggt gcggtccacc cccaccgcca      6780
     cccccacccc cactggagca agggttcaat atcaccagag aaaggtttta cctgctctgt      6840
     gtctgcccag taacttgttc caatttcctt aagtaaaagc aacttttttc tttctttcga      6900
     gtttggttga gcatcacaat cagcaggcta acaggcagtt agatcaggcg gtgtgcgcct      6960
     gggcgattga gctgggctcc tttctgtgct gggcatatgg actggttcaa gagagaagaa      7020
     atatgggcat ctttgtgtca cacttgtgtc catagtatgt gcgtatgtgc acccacgtgg      7080
     tatgtgtgcg ccccacccca cccccgcaca aaagcctgta gaaccccgtt tgggtttgcc      7140
     tgcagggagt tctaaatctg gggctatttg aaagcaagaa caaaccactg tctctgcttc      7200
     tgcttctgaa acgagaatcg gtaactgcat ttttctgtcc cacgagatat gcaaaagcaa      7260
     tgcaataata tccattttaa aatatgggtg tgagttgtgt cagcattaaa attctatttt      7320
     aaaaaaaaaa aaccacgaaa tttaagggaa aaactcaaga agacattttg cttcgatata      7380
     ttctgtgtaa tgttttattg cattgataat gtttctgttg aagaaactgt tatacttgaa      7440
     ttcaggtcag tttcagtatt tttcaaatat ttttttaaaa ctgaattgca attgtgccaa      7500
     gcaaatacaa tgacttaagt ttgttttaaa attcacttct tgtatatttt gctgcatgta      7560
     aagtaaatcg ttttgtattt gg                                               7582
//


spacer
spacer