spacer

EBI Dbfetch

ID   U17381; SV 1; linear; mRNA; STD; HUM; 340 BP.
XX
AC   U17381;
XX
DT   03-JUN-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I HLA-DRB1 gene (HLA-DRB1308V allele) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-340
RX   DOI; 10.1111/j.1399-0039.1995.tb02458.x.
RX   PUBMED; 7652736.
RA   Robbins F., Tang T., Yao H., Ng J., Hartzman R.J., Hurley C.K.;
RT   "Direct sequencing of SSP-PCR-amplified cDNA to identify new alleles in the
RT   DR52-associated DRB1 group: identification of DRB1*1115, DRB1*1117 and
RT   DRB1*1319";
RL   Tissue Antigens 45(5):302-308(1995).
XX
RN   [2]
RP   1-340
RA   Robbins F.Y.;
RT   ;
RL   Submitted (21-NOV-1994) to the INSDC.
RL   Fu-Meei Y. Robbins, Pediatrics Dept./Bone Marrow Program, Georgetown
RL   University, 3800 Reservoir Road, Washington, DC 20007, USA
XX
DR   MD5; 957eeccaa041650eaab5185dbdacf9cf.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..340
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="GN033"
FT                   /cell_type="lymphoblast"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>340
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="HLA-DRB1308V allele"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAC50167.1"
FT                   /translation="LALAGDTRPRFLEYSTSECHFFNGTERVRFLERYFHNQEEFVRFD
FT                   SDVGEYRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVHPKVT
FT                   VYPSKTQPL"
XX
SQ   Sequence 340 BP; 72 A; 87 C; 114 G; 67 T; 0 other;
     cactggcttt ggctggggac accagaccac gtttcttgga gtactctacg tctgagtgtc        60
     atttcttcaa tgggacggag cgggtgcggt tcctggagag atacttccat aaccaggagg       120
     agttcgtgcg cttcgacagc gacgtggggg agtaccgggc ggtgacggag ctggggcggc       180
     ctgatgccga gtactggaac agccagaagg acatcctgga agacgagcgg gccgcggtgg       240
     acacctactg cagacacaac tacggggttg tggagagctt cacagtgcag cggcgagtcc       300
     atcctaaggt gactgtgtat ccttcaaaga cccagcccct                             340
//


spacer
spacer