spacer

EBI Dbfetch

ID   U15784; SV 1; linear; mRNA; STD; MUS; 1462 BP.
XX
AC   U15784;
XX
DT   25-OCT-1994 (Rel. 41, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus Shcp52 (Shc) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1462
RX   PUBMED; 7798194.
RA   Blaikie P., Immanuel D., Wu J., Li N., Yajnik V., Margolis B.;
RT   "A region in Shc distinct from the SH2 domain can bind
RT   tyrosine-phosphorylated growth factor receptors";
RL   J Biol Chem 269(51):32031-32034(1994).
XX
RN   [2]
RP   1-1462
RA   Blaikie P.A.;
RT   ;
RL   Submitted (13-OCT-1994) to the INSDC.
RL   Pamela A. Blaikie, Pharmacology/Msb 249, New York University Medical
RL   Center, 550 First Avenue, New York, NY 10016, USA
XX
DR   MD5; b308a171db97dd76df14bff155450c7e.
DR   Ensembl-Gn; ENSMUSG00000042626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107417; mus_musculus.
DR   EuropePMC; PMC1559712; 16674811.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1462
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /cell_type="fibroblast"
FT                   /db_xref="taxon:10090"
FT   CDS             53..1462
FT                   /codon_start=1
FT                   /gene="Shc"
FT                   /product="Shcp52"
FT                   /db_xref="GOA:P98083"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR006019"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:98296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P98083"
FT                   /protein_id="AAC52146.1"
FT                   /translation="MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKV
FT                   MGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSR
FT                   PLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEY
FT                   VAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGF
FT                   DGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAARPTLPSAQMSSHLGATLP
FT                   IGQHAAGDHEVRKQMLPPPPCPGRELFDDPSYVNIQNLDKARQAGGGAGPPNPSLNGSA
FT                   PRDLFDMKPFEDALRVPPPPQSMSMAEQLQGEPWFHGKLSRREAEALLQLNGDFLVRES
FT                   TTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSE
FT                   LCLQQPVDRKV"
XX
SQ   Sequence 1462 BP; 324 A; 405 C; 441 G; 292 T; 0 other;
     cggaaccaga tcggcccgcg gtgcggtgcg gagactccat gagaccctgg acatgaacaa        60
     gctgagtgga ggcggcgggc gcaggactcg ggtagaaggg ggccagctgg ggggcgagga       120
     gtggaccaga cacgggagct ttgtcaataa gcccacacga ggctggctgc atcccaacga       180
     caaagtcatg ggacctgggg tttcctactt ggttcggtac atgggctgtg tggaggtctt       240
     acagtcaatg cgagcccttg acttcaatac ccggactcag gtcaccaggg aggccatcag       300
     tttggtgtgt gaagctgtgc ctggtgccaa aggggcgaca aggaggagaa agccttgtag       360
     ccgcccactc agctccatcc tggggaggag taacctgaag tttgctggaa tgccaatcac       420
     tctcactgtg tctaccagca gccttaacct catggcagcc gactgcaaac agatcattgc       480
     caaccatcac atgcaatcta tctctttcgc gtccggtggg gatccggaca cagctgagta       540
     tgttgcctat gttgccaaag accctgtgaa tcagagagcc tgccatatcc tggagtgtcc       600
     tgaagggctt gctcaggatg tcatcagcac catcgggcag gcctttgagt tgcgcttcaa       660
     acagtatctc aggaatccac cgaagctggt caccccccat gacaggatgg ctggctttga       720
     tggctcagct tgggatgagg aggaagaaga gccccctgac catcagtact acaatgactt       780
     tccagggaag gaaccccctc ttggtggggt ggtagatatg aggcttcggg aaggggctgc       840
     tcgacccact ctgcctagtg cccagatgtc cagccacttg ggagctacac tgcctatagg       900
     gcagcatgct gcaggagacc atgaagtccg taaacagatg ttgcctccgc cgccttgccc       960
     aggcagagaa ctcttcgatg acccctccta tgtcaacatc cagaatctag acaaggcccg      1020
     gcaggctggg ggtggggctg ggcccccaaa tccttctctt aatggcagtg caccccgaga      1080
     cctttttgac atgaagccct ttgaagatgc acttcgggtg ccacccccac cgcagtccat      1140
     gtccatggct gagcagctgc aaggggagcc ctggttccac gggaagctga gccggaggga      1200
     ggccgaggcg ctgctgcagc tcaatggtga cttcttggtg cgagagagca cgaccacgcc      1260
     tggccagtat gtgctcactg gcctgcagag tgggcagccc aagcacttgc tgctggtgga      1320
     ccctgaaggt gtggttcgga caaaggatca ccgctttgag agtgtcagtc acctgatcag      1380
     ctaccacatg gacaatcact tgcccatcat ctctgcgggc agcgaactgt gcctacagca      1440
     acccgtggat cggaaagtgt ga                                               1462
//


spacer
spacer