Dbfetch

ID   U14165; SV 1; linear; mRNA; STD; MUS; 1079 BP.
XX
AC   U14165;
XX
DT   27-SEP-1994 (Rel. 41, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus orphan opioid receptor (oOR) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1016/0165-5728(95)00030-6.
RX   PUBMED; 7797625.
RA   Halford W.P., Gebhardt B.M., Carr D.J.;
RT   "Functional role and sequence analysis of a lymphocyte orphan opioid
RT   receptor";
RL   J. Neuroimmunol. 59(1-2):91-101(1995).
XX
RN   [2]
RP   1-1079
RA   Halford W.P.;
RT   ;
RL   Submitted (31-AUG-1994) to the INSDC.
RL   William P. Halford, Microbiology, Immunology, & Parasitology, Louisiana
RL   State University Medical Center, 1901 Perdido St., New Orleans, LA 70112,
RL   USA
XX
DR   MD5; 8c14ee735c66b9ab7ed78989ddcbd5f0.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027036; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026972; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026752; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025947; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026283; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184127; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059991; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059927; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059579; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058879; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1079
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             9..>1079
FT                   /codon_start=1
FT                   /gene="oOR"
FT                   /product="orphan opioid receptor"
FT                   /function="splice junction between two exons"
FT                   /note="opioid-receptor like protein; oOR mRNA sequence was
FT                   obtained from lymphocytes by RT-PCR; because the nucleotide
FT                   sequence is partial, this translation lacks 10 C-terminal
FT                   amino acids found in the full length oOR cDNA"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA87899.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGC"
FT   misc_feature    218..232
FT                   /gene="oOR"
FT                   /note="This intron motif appears to be spliced out of
FT                   approximately half of the oOR transcripts found in brain
FT                   and lymphocytes.; In lymphocytes, a large fraction of oOR
FT                   poly(A)+ transcripts contain an 81 base intron between
FT                   bases 588 and 589"
XX
SQ   Sequence 1079 BP; 197 A; 300 C; 279 G; 303 T; 0 other;
     gtgacagcat ggagtccctc tttcctgccc cattctggga ggtcttgtat ggcagccact        60
     ttcaagggaa cctgtctctc ctaaatgaga ccgtacccca tcacctgctc ctcaatgcta       120
     gccacagtgc cttcctgccc cttggactca aggtcaccat cgtggggctc tacttggctg       180
     tgtgcatcgg ggggctcctg gggaactgcc tcgtcatgta tgtcatcctc aggcacacca       240
     agatgaagac tgctaccaac atttacatat ttaatctggc actggctgat accctggtct       300
     tgctgacact gcccttccag ggcacagaca tccttctggg cttctggcca tttgggaatg       360
     cactgtgcaa gacggtcatt gctatcgact actacaacat gtttaccagc actttcactt       420
     tgactgccat gagtgtagac cgttatgtag ctatctgcca ccctatccgt gcccttgatg       480
     ttcggacatc cagtaaagcc caggccgtta atgtggccat atgggccctg gcttcggtgg       540
     ttggtgttcc tgttgccatc atgggctcag cacaagtgga ggatgaagag atcgagtgcc       600
     tggtggagat ccccgcccct caggactatt ggggccctgt atttgccatc tgcatcttcc       660
     ttttttcctt catcatcccg gttctgatca tctctgtctg ctacagcctc atgattcgac       720
     gacttcgtgg tgtccggctg ctttcaggct cccgagagaa ggaccggaac ctgcgacgca       780
     tcacacggct ggtactggta gttgtggctg tgtttgtggg ctgctggaca cctgtgcagg       840
     tctttgtcct ggttcaagga ctgggtgttc agccaggtag tgagactgca gtagccattc       900
     tgcgcttctg cacagccctg ggctatgtca acagttgtct caatcccatt ctctatgctt       960
     tcttggatga gaacttcaag gcctgcttta gaaagttctg ctgtgcttct gccctgcacc      1020
     gggagatgca ggtttctgat cgtgtgcgca gcattgccaa ggatgtaggc cttggttgc       1079
//