spacer

EBI Dbfetch

ID   U10375; SV 1; linear; mRNA; STD; MUS; 1323 BP.
XX
AC   U10375;
XX
DT   04-JUL-1994 (Rel. 40, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus peroxisome proliferator-activated receptor delta mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1323
RX   DOI; 10.1073/pnas.91.15.7355.
RX   PUBMED; 8041794.
RA   Kliewer S.A., Forman B.M., Blumberg B., Ong E.S., Borgmeyer U.,
RA   Mangelsdorf D.J., Umesono K., Evans R.M.;
RT   "Differential expression and activation of a family of murine peroxisome
RT   proliferator-activated receptors";
RL   Proc. Natl. Acad. Sci. U.S.A. 91(15):7355-7359(1994).
XX
RN   [2]
RP   1-1323
RA   Forman B.M.;
RT   ;
RL   Submitted (06-JUN-1994) to the INSDC.
RL   Barry M. Forman, Gene Expression Laboratory, The Salk Institute for
RL   Biological Studies, P.O. Box 85800, San Diego, CA 92186-5800, USA
XX
DR   MD5; 604cb953dfc13fa4a291ec568615b43d.
DR   Ensembl-Gn; ENSMUSG00000002250; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002320; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1323
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda zap"
FT                   /clone="mPPARd1"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1323
FT                   /codon_start=1
FT                   /standard_name="PPAR delta"
FT                   /product="peroxisome proliferator-activated receptor delta"
FT                   /db_xref="GOA:P35396"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003075"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:101884"
FT                   /protein_id="AAA19972.1"
FT                   /translation="MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLS
FT                   QNSSPSSLLDQLQMGCDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMK
FT                   LEYEKCDRICKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPDGEKRKLVAGLTASE
FT                   GCQHNPQLADLKAFSKHIYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAE
FT                   KGLVWKQLVNGLPPYNEISVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLL
FT                   KYGVHEAIFAMLASIVNKDGLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNAL
FT                   ELDDSDLALFIAAIILCGDRPGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLL
FT                   QKMADLRQLVTEHAQMMQWLKKTESETLLHPLLQEIYKDMY"
XX
SQ   Sequence 1323 BP; 313 A; 400 C; 376 G; 234 T; 0 other;
     atggaacagc cacaggagga gacccctgag gcccgggaag aggagaaaga ggaagtggcc        60
     atgggtgacg gagccccgga gctcaatggg ggaccagaac acacgcttcc ttccagcagc       120
     tgtgcagacc tctcccagaa ttcctcccct tcctccctgc tggaccagct gcagatgggc       180
     tgtgatgggg cctcaggcgg cagcctcaac atggaatgtc gggtgtgcgg ggacaaggcc       240
     tcgggcttcc actacggggt ccacgcgtgc gaggggtgca agggcttctt ccgccggaca       300
     atccgcatga agctcgagta tgagaagtgc gatcggatct gcaagatcca gaagaagaac       360
     cgcaacaagt gtcagtactg ccgcttccag aagtgcctgg cactcggcat gtcgcacaac       420
     gctatccgct ttggacggat gccggacggc gagaagagga agctggtggc ggggctgact       480
     gccagcgagg ggtgccagca caacccccag ctggccgacc tgaaggcctt ctctaagcac       540
     atctacaacg cctacctgaa aaacttcaac atgaccaaaa agaaggcccg gagcatcctc       600
     accggcaagt ccagccacaa cgcacccttt gtcatccacg acatcgagac actgtggcag       660
     gcagagaagg gcctggtgtg gaaacagctg gtgaacgggc tgccgcccta caacgagatc       720
     agtgtgcacg tgttctaccg ctgccagtcc accacagtgg agacagtccg agagctcacc       780
     gagttcgcca agaacatccc caacttcagc agcctcttcc tcaatgacca ggtgaccctc       840
     ctcaagtatg gcgtgcacga ggccatcttt gccatgctgg cctccatcgt caacaaagac       900
     gggctgctgg tggccaacgg cagtggcttc gtcacccacg agttcttgcg aagtctccgc       960
     aagcccttca gtgacatcat tgagcccaag ttcgagtttg ctgtcaagtt caatgcgctg      1020
     gagctcgatg acagtgacct ggcgctcttc atcgcggcca tcattctgtg tggagaccgg      1080
     ccaggcctca tgaatgtgcc ccaggtagaa gccatccagg acaccattct gcgggctcta      1140
     gaattccatc tgcaggtcaa ccaccctgac agccagtacc tcttccccaa gctgctgcag      1200
     aagatggcag acctgcggca gctggtcact gagcatgccc agatgatgca gtggctaaag      1260
     aagacggaga gtgagacctt gctgcacccc ctgctccagg aaatctacaa ggacatgtac      1320
     taa                                                                    1323
//


spacer
spacer