spacer

EBI Dbfetch

ID   U10374; SV 1; linear; mRNA; STD; MUS; 1428 BP.
XX
AC   U10374;
XX
DT   04-JUL-1994 (Rel. 40, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus peroxisome proliferator-activated receptor gamma mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1428
RX   DOI; 10.1073/pnas.91.15.7355.
RX   PUBMED; 8041794.
RA   Kliewer S.A., Forman B.M., Blumberg B., Ong E.S., Borgmeyer U.,
RA   Mangelsdorf D.J., Umesono K., Evans R.M.;
RT   "Differential expression and activation of a family of murine peroxisome
RT   proliferator-activated receptors";
RL   Proc. Natl. Acad. Sci. U.S.A. 91(15):7355-7359(1994).
XX
RN   [2]
RP   1-1428
RA   Forman B.M.;
RT   ;
RL   Submitted (06-JUN-1994) to the INSDC.
RL   Barry M. Forman, Gene Expression Laboratory, The Salk Institute for
RL   Biological Studies, P.O. Box 85800, San Diego, CA 92186-5800, USA
XX
DR   MD5; 1a383451edf02ae80de81c1d4ba65e49.
DR   EuropePMC; PMC33252; 11320206.
DR   EuropePMC; PMC523004; 15501793.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1428
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda zap"
FT                   /clone="mPPAR-gamma1"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1428
FT                   /codon_start=1
FT                   /standard_name="PPAR gamma"
FT                   /product="peroxisome proliferator-activated receptor gamma"
FT                   /db_xref="GOA:P37238"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37238"
FT                   /protein_id="AAA19971.1"
FT                   /translation="MVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISA
FT                   PHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSL
FT                   MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYC
FT                   RFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIK
FT                   SFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQ
FT                   GCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLIS
FT                   EGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLL
FT                   NVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTE
FT                   TDMSLHPLLQEIYKDLY"
XX
SQ   Sequence 1428 BP; 403 A; 351 C; 333 G; 341 T; 0 other;
     atggttgaca cagagatgcc attctggccc accaacttcg gaatcagctc tgtggacctc        60
     tccgtgatgg aagaccactc gcattccttt gacatcaagc cctttaccac agttgatttc       120
     tccagcattt ctgctccaca ctatgaagac attccattca caagagctga cccaatggtt       180
     gctgattaca aatatgacct gaagctccaa gaataccaaa gtgcgatcaa agtagaacct       240
     gcatctccac cttattattc tgaaaagacc cagctctaca acaggcctca tgaagaacct       300
     tctaactccc tcatggccat tgagtgccga gtctgtgggg ataaagcatc aggcttccac       360
     tatggagttc atgcttgtga aggatgcaag ggttttttcc gaagaaccat ccgattgaag       420
     cttatttatg ataggtgtga tcttaactgc cggatccaca aaaaaagtag aaataaatgt       480
     cagtactgtc ggtttcagaa gtgccttgct gtggggatgt ctcacaatgc catcaggttt       540
     gggcggatgc cacaggccga gaaggagaag ctgttggcgg agatctccag tgatatcgac       600
     cagctgaacc cagagtctgc tgatctgcga gccctggcaa agcatttgta tgactcatac       660
     ataaagtcct tcccgctgac caaagccaag gcgagggcga tcttgacagg aaagacaacg       720
     gacaaatcac catttgtcat ctacgacatg aattccttaa tgatgggaga agataaaatc       780
     aagttcaaac atatcacccc cctgcaggag cagagcaaag aggtggccat ccgaattttt       840
     caagggtgcc agtttcgatc cgtagaagcc gtgcaagaga tcacagagta tgccaaaaat       900
     atccctggtt tcattaacct tgatttgaat gaccaagtga ctctgctcaa gtatggtgtc       960
     catgagatca tctacacgat gctggcctcc ctgatgaata aagatggagt cctcatctca      1020
     gagggccaag gattcatgac cagggagttc ctcaaaagcc tgcggaagcc ctttggtgac      1080
     tttatggagc ctaagtttga gtttgctgtg aagttcaatg cactggaatt agatgacagt      1140
     gacttggcta tatttatagc tgtcattatt ctcagtggag accgcccagg cttgctgaac      1200
     gtgaagccca tcgaggacat ccaagacaac ctgctgcagg ccctggaact gcagctcaag      1260
     ctgaatcacc cagagtcctc tcagctgttc gccaaggtgc tccagaagat gacagacctc      1320
     aggcagatcg tcacagagca cgtgcagcta ctgcatgtga tcaagaagac agagacagac      1380
     atgagccttc accccctgct ccaggagatc tacaaggact tgtattag                   1428
//


spacer
spacer