spacer

EBI Dbfetch

ID   U09421; SV 1; linear; mRNA; STD; MUS; 2600 BP.
XX
AC   U09421;
XX
DT   02-OCT-1994 (Rel. 41, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus K3 opiate receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2600
RX   PUBMED; 7603458.
RA   Pan Y.X., Cheng J., Xu J., Rossi G., Jacobson E., Ryan-Moro J.,
RA   Brooks A.I., Dean G.E., Standifer K.M., Pasternak G.W.;
RT   "Cloning and functional characterization through antisense mapping of a
RT   kappa 3-related opioid receptor";
RL   Mol. Pharmacol. 47(6):1180-1188(1995).
XX
RN   [2]
RP   1-2600
RA   Pasternak G.W.;
RT   ;
RL   Submitted (04-MAY-1994) to the INSDC.
RL   Gavril W. Pasternak, Cotzias Lab of Neuro-Oncology, Memorial Sloan
RL   Kettering Cancer Center, 1275 York Avenue, New York, NY 10021, USA
XX
DR   MD5; 7bf29fb36669495b7e4178c9fdc894f2.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184127; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2600
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="mouse cDNA brain library"
FT                   /clone="13-2A4"
FT                   /db_xref="taxon:10090"
FT   CDS             299..1402
FT                   /codon_start=1
FT                   /product="K3 opiate receptor"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAA81333.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRTVAKDVGLGCKTSETVPRPA"
XX
SQ   Sequence 2600 BP; 535 A; 681 C; 663 G; 721 T; 0 other;
     tttggcttcc ttctccaacc tgcgcagccc ctccttctct cagccgcagc cttctgcccc        60
     tcccccttct ggctgccgca ctggctgctg cgtctagtca atatcttatc ttcggagcag       120
     gagctaggag ccattcccag ccggagcaga ccccaagcta gagtgagaag cattactcag       180
     ttcattgtgc tcctgcctgc ctttctgcta agcattaggg tctgttttgg cccagcttct       240
     gaagaggttg tgtgtgctgt tggaggaact gtactgagtg gctttgcagg gtgacagcat       300
     ggagtccctc tttcctgccc cattctggga ggtcttgtat ggcagccact ttcaagggaa       360
     cctgtctctc ctaaatgaga ccgtacccca tcacctgctc ctcaatgcta gccacagtgc       420
     cttcctgccc cttggactca aggtcaccat cgtggggctc tacttggctg tgtgcatcgg       480
     ggggctcctg gggaactgcc tcgtcatgta tgtcatcctc aggcacacca agatgaagac       540
     tgctaccaac atttacatat ttaatctggc actggctgat accctggtct tgctgacact       600
     gcccttccag ggcacagaca tccttctggg cttctggcca tttgggaatg cactgtgcaa       660
     gacggtcatt gctatcgact actacaacat gtttaccagc actttcactt tgactgccat       720
     gagtgtagac cgttatgtag ctatctgcca ccctatccgt gcccttgatg ttcggacatc       780
     cagtaaagcc caggccgtta atgtggccat atgggccctg gcttcggtgg ttggtgttcc       840
     tgttgccatc atgggctcag cacaagtgga ggatgaagag atcgagtgcc tggtggagat       900
     ccccgcccct caggactatt ggggccctgt atttgccatc tgcatcttcc ttttttcctt       960
     catcatcccg gttctgatca tctctgtctg ctacagcctc atgattcgac gacttcgtgg      1020
     tgtccggctg ctttcaggct cccgagagaa ggaccggaac ctgcgacgca tcacacggct      1080
     ggtactggta gttgtggctg tgtttgtggg ctgctggaca cctgtgcagg tctttgtcct      1140
     ggttcaagga ctgggtgttc agccaggtag tgagactgca gtagccattc tgcgcttctg      1200
     cacagccctg ggctatgtca acagttgtct caatcccatt ctctatgctt tcttggatga      1260
     gaacttcaag gcctgcttta gaaagttctg ctgtgcttct gccctgcacc gggagatgca      1320
     ggtttctgat cgtgtgcgca cagttgccaa ggatgtaggc cttggttgca agacctctga      1380
     gacagtacca cggccggcat gactaggcgt ggacctgccc atggtgcctg tcagtcctag      1440
     aggaagacct tttagcacca tgggacaggt caaagcatca aggtggcctc catggctctg      1500
     tcagattaag tttcctccct ggtataggac cagagagaac caaaggaact gcatggaaac      1560
     atccacaact cagtggacat gcctggtgaa cccatgtagg tattcatggt tcacttgact      1620
     cttctctggt ttctccctgc tgccctggtt ctaggtgggc tcagctgagg tattgtagtt      1680
     gtcatgtagt cactattgtg actacctgtt gtgtgctatt gccctcagcc ttcagtgttt      1740
     gcacagaact ggtgatcata cccagtgttg cctggccctt aagcttggag ttgccttgga      1800
     gcatctagtt ctgactccac tgatgcattc agattacctg aggtgggtga gcatcagtgg      1860
     gttcttggat gactgtttcc tgacgattct tttcatgctg tactatggtg tatatgaagg      1920
     ggacttcaca cttcatctgg tactgccact gcctgctcta ccaacctgga ccaccttctc      1980
     agcaagaggc tagcaggggg acaagacaca aagcttccct aaggctcttt ccctccaaaa      2040
     ccactgtgaa ctcttattct acagactgtt tggcaagccc tgcttctaac tgtgtgggaa      2100
     gtaatcagga gaaaattctg tggcctctgt aggctgctca cagcatggag gcaccacatg      2160
     ctggtcttgg gtatgtgtct tggctgctca gtatgggcag ggcagggcac gagactatct      2220
     ctctccttat tctccacagc ctccctcagc tctccagcag tcgctctttt acttgacagt      2280
     agaggttagc agcagttgta ctcgtagaaa cacacttgta gcccgggaag actggagtca      2340
     ggatgtgttc tattctatac ccacagtgac cacctgcttc atttataggg ttaggacata      2400
     tccaagcaag gcctgggctt ggcatcaaat gaagagctgg tatgagagct gaagcctaaa      2460
     atggctcatt tgagcaatct gcaaggacta ttacggtttt ggggacattg gaagaagagt      2520
     cgataccttg gagatatatt gttggttcac agaagaagag gctttgtaaa tgccctttct      2580
     atgggtcaga taaaaaaaaa                                                  2600
//


spacer
spacer