spacer

EBI Dbfetch

ID   U09138; SV 1; linear; mRNA; STD; MUS; 1780 BP.
XX
AC   U09138;
XX
DT   26-JUN-1994 (Rel. 40, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus peroxisome proliferator activated protein-gamma-2 mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1780
RX   PUBMED; 7926726.
RA   Tontonoz P., Hu E., Graves R.A., Budavari A.I., Spiegelman B.M.;
RT   "mPPAR gamma 2: tissue-specific regulator of an adipocyte enhancer";
RL   Genes Dev. 8(10):1224-1234(1994).
XX
RN   [2]
RP   1-1780
RA   Hu E.;
RT   ;
RL   Submitted (21-APR-1994) to the INSDC.
RL   Erding Hu, Cell and Molecular Biology, Dana-Farber Cancer Institute, 44
RL   Binney Street, Boston, MA 02115, USA
XX
DR   MD5; 39ce4d38735351c9b219a37104b6afa3.
DR   EuropePMC; PMC21174; 9671776.
DR   EuropePMC; PMC2432036; 18584035.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1780
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda ZapII library"
FT                   /cell_line="3T3-F442A"
FT                   /tissue_type="adipose tissue"
FT                   /db_xref="taxon:10090"
FT   CDS             40..1557
FT                   /codon_start=1
FT                   /product="peroxisome proliferator activated
FT                   protein-gamma-2"
FT                   /db_xref="GOA:P37238"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37238"
FT                   /protein_id="AAA62277.1"
FT                   /translation="MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGI
FT                   SSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQS
FT                   AIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFF
FT                   RRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLL
FT                   AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMN
FT                   SLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLN
FT                   DQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFA
FT                   VKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ
FT                   LFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY"
XX
SQ   Sequence 1780 BP; 531 A; 412 C; 387 G; 450 T; 0 other;
     cccagtgtga attacagcaa atctctgttt tatgctgtta tgggtgaaac tctgggagat        60
     tctcctgttg acccagagca tggtgccttc gctgatgcac tgcctatgag cacttcacaa       120
     gaaattacca tggttgacac agagatgcca ttctggccca ccaacttcgg aatcagctct       180
     gtggacctct ccgtgatgga agaccactcg cattcctttg acatcaagcc ctttaccaca       240
     gttgatttct ccagcatttc tgctccacac tatgaagaca ttccattcac aagagctgac       300
     ccaatggttg ctgattacaa atatgacctg aagctccaag aataccaaag tgcgatcaaa       360
     gtagaacctg catctccacc ttattattct gaaaagaccc agctctacaa caggcctcat       420
     gaagaacctt ctaactccct catggccatt gagtgccgag tctgtgggga taaagcatca       480
     ggcttccact atggagttca tgcttgtgaa ggatgcaagg gttttttccg aagaaccatc       540
     cgattgaagc ttatttatga taggtgtgat cttaactgcc ggatccacaa aaaaagtaga       600
     aataaatgtc agtactgtcg gtttcagaag tgccttgctg tggggatgtc tcacaatgcc       660
     atcaggtttg ggcggatgcc acaggccgag aaggagaagc tgttggcgga gatctccagt       720
     gatatcgacc agctgaaccc agagtctgct gatctgcgag ccctggcaaa gcatttgtat       780
     gactcataca taaagtcctt cccgctgacc aaagccaagg cgagggcgat cttgacagga       840
     aagacaacgg acaaatcacc atttgtcatc tacgacatga attccttaat gatgggagaa       900
     gataaaatca agttcaaaca tatcaccccc ctgcaggagc agagcaaaga ggtggccatc       960
     cgaatttttc aagggtgcca gtttcgatcc gtagaagccg tgcaagagat cacagagtat      1020
     gccaaaaata tccctggttt cattaacctt gatttgaatg accaagtgac tctgctcaag      1080
     tatggtgtcc atgagatcat ctacacgatg ctggcctccc tgatgaataa agatggagtc      1140
     ctcatctcag agggccaagg attcatgacc agggagttcc tcaaaaacct gcggaagccc      1200
     tttggtgact ttatggagcc taagtttgag tttgctgtga agttcaatgc actggaatta      1260
     gatgacagtg acttggctat atttatagct gtcattattc tcagtggaga ccgcccaggc      1320
     ttgctgaacg tgaagcccat cgaggacatc caagacaacc tgctgcaggc cctggaactg      1380
     cagctcaagc tgaatcaccc agagtcctct cagctgttcg ccaaggtgct ccagaagatg      1440
     acagacctca ggcagatcgt cacagagcac gtgcagctac tgcatgtgat caagaagaca      1500
     gagacagaca tgagccttca ccccctgctc caggagatct acaaggactt gtattagcag      1560
     gaaagtccca cccgctgaca acgtgttcct tctattgatt gcactattat tttgagggaa      1620
     aaaaatctga cacctaagaa atttactgtg aaaaagcatt taaaaacaaa agttttagaa      1680
     gatgatgatc tattttatgc atattgttta taaagataca tttacaattt acttttaata      1740
     ttaaaaatta ccacattata aaattaaaaa aaaaaaaaaa                            1780
//


spacer
spacer