spacer

EBI Dbfetch

ID   U08338; SV 1; linear; unassigned DNA; STD; MUS; 375 BP.
XX
AC   U08338;
XX
DT   21-MAY-1994 (Rel. 39, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus BALB/c putative growth factor GDF6 (Gdf6) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-375
RX   DOI; 10.1038/368639a0.
RX   PUBMED; 8145850.
RA   Storm E.E., Huynh T.V., Copeland N.G., Jenkins N.A., Kingsley D.M., Lee S.;
RT   "Limb alterations in brachypodism mice due to mutations in a new member of
RT   the TGF beta-superfamily";
RL   Nature 368(6472):639-643(1994).
XX
RN   [2]
RP   1-375
RA   Lee S.;
RT   ;
RL   Submitted (05-APR-1994) to the INSDC.
RL   Se-Jin Lee, Dept. of Molecular Biology and Genetics, The Johns Hopkins
RL   University School of Medicine, 725 N. Wolfe St., Room 607 PCTB, Baltimore,
RL   MD 21205, USA
XX
DR   MD5; 98ac8796cb7426a3689d66e330cdb238.
DR   Ensembl-Gn; ENSMUSG00000051279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057613; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..375
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /strain="BALB/c"
FT                   /mol_type="unassigned DNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="adult liver genomic DNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>375
FT                   /codon_start=1
FT                   /gene="Gdf6"
FT                   /product="GDF6"
FT                   /note="putative growth factor; secreted; related to
FT                   TGF-beta, bone morphogenetic proteins, and GDF5 and GDF7"
FT                   /db_xref="GOA:P43028"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR002405"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:95689"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43028"
FT                   /protein_id="AAA18779.1"
FT                   /translation="RRRRRTAFASRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAP
FT                   LEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYID
FT                   AGNNVVYKQYEDMVVESCGCR"
FT   mat_peptide     16..>375
FT                   /gene="Gdf6"
FT                   /product="GDF6"
XX
SQ   Sequence 375 BP; 80 A; 117 C; 106 G; 72 T; 0 other;
     cgccggcggc gacgcaccgc cttcgccagc cgtcacggca agcgacatgg caagaagtcc        60
     aggctgcgct gcagcagaaa gcctctgcac gtgaatttta aggagttagg ctgggacgac       120
     tggattatcg cgcccctaga gtacgaggcc tatcactgcg agggcgtgtg cgactttccg       180
     ctgcgctcgc accttgagcc cactaaccat gccatcattc agacgctgat gaactccatg       240
     gacccgggct ccaccccgcc tagctgctgc gttcccacca aactgactcc cattagcatc       300
     ctgtacatcg acgcgggcaa taatgtagtc tacaagcagt atgaggacat ggtggtggag       360
     tcctgcggct gtagg                                                        375
//


spacer
spacer