Dbfetch

ID   U06977; SV 1; linear; genomic DNA; STD; MUS; 3811 BP.
XX
AC   U06977;
XX
DT   25-MAR-1994 (Rel. 39, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Mus musculus alpha-2-macroglobulin gene, 5' region and exons 1-4, partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1006/geno.1994.1425.
RX   PUBMED; 7528166.
RA   Umans L., Serneels L., Hilliker C., Stas L., Overbergh L., De Strooper B.,
RA   Van Leuven F., Van den Berghe H.;
RT   "Molecular cloning of the mouse gene coding for alpha 2-macroglobulin and
RT   targeting of the gene in embryonic stem cells";
RL   Genomics 22(3):519-529(1994).
XX
RN   [2]
RP   1-3811
RA   Van Leuven F.;
RT   ;
RL   Submitted (21-FEB-1994) to the INSDC.
RL   Fred Van Leuven, K.U.Leuven, Campus Gasthuisberg ON6, Leuven B-3000,
RL   Belgium
XX
DR   MD5; 9df8c4d4697d062143f2686ae5c93c53.
DR   Ensembl-Gn; ENSMUSG00000030359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112132; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3811
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   exon            825..959
FT                   /number=1
FT   CDS             join(874..959,2188..2377,3373..3526,3667..>3719)
FT                   /codon_start=1
FT                   /product="alpha-2-macroglobulin"
FT                   /db_xref="GOA:Q61838"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR009048"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019565"
FT                   /db_xref="InterPro:IPR019742"
FT                   /db_xref="MGI:MGI:87854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61838"
FT                   /protein_id="AAA87890.1"
FT                   /translation="MRRNQLPTPAFLLLFLLLPRDATTATAKPQYVVLVPSEVYSGIPE
FT                   KACVSLNHVNETVMLSLTLEYAMQQTKLLTDQAVDKDSFYCSPFTVSGSPLPYTFITVE
FT                   IKGPTQRFIKKKSIQIIKAESPVFVQTDKPIYKPGQIGIIRVVSVDISFRPLNETVS"
FT   intron          960..2187
FT                   /number=1
FT   exon            2188..2377
FT                   /number=2
FT   intron          2378..3372
FT                   /number=2
FT   exon            3373..3526
FT                   /number=3
FT   intron          3527..3666
FT                   /number=3
FT   exon            3667..3719
FT                   /number=4
FT   intron          3720..>3811
FT                   /number=4
XX
SQ   Sequence 3811 BP; 1105 A; 825 C; 784 G; 1097 T; 0 other;
     tctagaatca gtgagagcct caaaaaatat gttcaaggca tctacagagc taattccagg        60
     atatccagtt ctacacaaag aaaccctatc tcaaaaaaca aaaaagagga ggaagaggag       120
     gaggaagaag aggaagagga aggaggagga ggaggggagg aaagggagga gagggaagga       180
     aaatagggaa gttacctgat aacaatctct gactgccaca cccacatgca ccctcagaca       240
     cacacactcc tgttgcatca cacttctcct aggaaggcct gacacaaaca tctattcacc       300
     ccagataagg atgtaatgac aaaacaaagt aatgattcta ccaaagtcta acttggcttt       360
     acttttttca atttctaaaa ataaaaaata aaattgaagc acatacctcc aaacttacct       420
     ttttctaaca ttcagtggta aatttcatta tgtccttcag tgaatgcaat actccaagtt       480
     aggaagagga aattgatatt gtatatttgc attcactgtc ctttttttaa aaaaaaatgg       540
     acaggtgtat tgattgactt caccaaacca tgtgatttct ttcatttttc ttttaaatgt       600
     ctaagtcctg tgtattatta accgtgagct agtggcagcc tgcaagcacc atctttcaaa       660
     tatttgggta acttttaggg aagtggaata aagaacatac atagtcctag aaaatggtct       720
     ggaattgatt ttttaatagt taatatgtta caaaaataaa tggttggcag tttactttca       780
     ctgcccatca ggtaaaataa aaagcagcgg aactggacaa ggatcagagt tcgggggctg       840
     agggctcaga cgttcttctc tgccctctcc accatgagga gaaaccagct gcccacacca       900
     gcttttcttt tactgttcct gcttcttccc agagatgcca ccacagctac tgcaaaaccg       960
     taagctaatc tttttttttt tttttttttt ggcttttcaa gacagggttt ctctgtgtag      1020
     ccctggctgt cctggaactc actctgtaga ccaggctggc ctcgaactca gaaatccaac      1080
     tgcctctgcc tcccaagtgc tgggattaaa ggcgtgacga ccactgcctg gtctataagc      1140
     tattcttctt tccaaaaaat tctattgtgt ccttccttcc ttcccacaat actatctctt      1200
     ttctggtttc ctaggcagta atctattgtc aaaaaacttg gaaggacttg gaagttgttg      1260
     gattgaaaag caattcagct tctccctgtg tgttgtgcgt tagtttctag tgcttcctgg      1320
     ataagatttg taatgctcac atggaaccca aggccacaag cagttgggtt tttaagactc      1380
     atggtttgga aattcggaat ttctaactga gacacatcat agctgtcgca tcagactgtg      1440
     tgtgtgtgtg tgtgtgtgtg tgtgtgtgtg tgtgtatgag gtgacacaac ctgacacaaa      1500
     catttaccca gcctggagga tagggaacaa acattagtga ttcttccaaa gtccaactta      1560
     ataaaccagt gtgttcgtgg gtggcctcta ggaatgagac aggggttgct tacagaaacg      1620
     cacatgattc aaagacaact gtcactaaca ggcacattcc tggactccct gcttgacctg      1680
     aaggtagctc agctggtagg agagtctcct ccaggtgact tggctggtcc aggagtctct      1740
     tagaagcagc tctgcctcct ctcctctgtc taacagtttt ttgctgcctc tgtaaccatg      1800
     gagagactgc atcaatcctg ttagcctccg ctcatgaaat ttacctcttg gtatctcaaa      1860
     cctccctcct ccctcctccc tcctccctcc tccctcctcc ctcctccctc ctccctcctc      1920
     cctcctccct cctccctcca ggaaggaatg tttcgatttg gaggaaattg ctacatggcc      1980
     ataacttgaa ttggttgccg gtgtttctga tattctgtgg gtgaactcca gagaatcaca      2040
     acaatgtctc atcttaggtt tatgttgacc tctgggaaac ccagtcttca tgaaacctat      2100
     gattgatggc aatatgaaaa atactagaaa acaatcgcaa taatgacgtc ttctgaatcc      2160
     ttcctggttg gtcctcttcc cccgcagaca atatgtggtg ctggtcccgt cagaggtcta      2220
     ttcaggaatc cctgaaaagg cctgtgtcag cctcaaccat gtgaatgaga ctgtgatgct      2280
     cagcttaact ctagagtatg caatgcagca aacgaagctc ctcacagacc aggctgtgga      2340
     taaggactcc ttctactgca gccccttcac ggtcagtgtc ctgcctggga tgtgcggtac      2400
     tggaaaaaaa aaaaaaaaaa aaaaaagagt aattgagttg aatgttgtat tctcattcat      2460
     caaaaaatat ttaaattaag gaaaaataat gaatacaaag tatacttcta atctccttta      2520
     tgatacttac aaactggtct aatgaaggtt accatagcca taagaaagac ttatttttta      2580
     ctttaaaata aacttttgtg gtaaacaata tttatacttt tacaaatata aatattgaga      2640
     ttctcttttt taaagattta ttctttatgt atatgagtac actgcagctg tcttcagacg      2700
     caaccagaga ggcatctgta ttccattaca gatggttgtg agcacatgtg gttgctggga      2760
     attgaactca gacctctgaa aagaacagtt agtgctctta gccactgagc tgtctctcca      2820
     gccccttgag attctttttt aagatttatt ttcagattaa attgtgtctc tgtgtatgtg      2880
     cacatgagtg caggtaacca ttgaggccag aagagggcac catggagcta gaactgtggg      2940
     cagttgtgag cctcctgata tggatgtggt accggtaccc taatttaggt cctctccaaa      3000
     agcagtgtgt acccttaagt gctaaaccat ctctccagcc tttgaatact gatcttctta      3060
     aaagccaaat tattcatgta agatagatgg cagatggtgg ccttggaagg tggaatagga      3120
     aaattatttt taatagcaag acttcgctgt gaaaatacaa ggacaccatc ttattcactg      3180
     ccctgactgc actgaagaat ggtctgttgt tcctgcaatg tttctcctaa aatcatgtta      3240
     ctcggtcaca ggaatgagtc cttgacaccc cttaccagtt ctcaaggatt cacaaagaaa      3300
     acagatccct gtagactctg agcacccaga agtgaatccg aacttactct ctacggtttt      3360
     ctgcagatct caggttcacc tttaccctac acattcatta ctgtggagat aaaaggacca      3420
     acgcagcgct tcataaagaa gaagtcaata caaataataa aagctgagag cccagtcttt      3480
     gtccagacag acaaacccat atacaaacca ggacagatag gtataaagaa ttcactgggc      3540
     aaaaacaaca cagtgggtga ggaggcctgg tggtgttctt tacgattaaa ctgcagtcat      3600
     gggaactctg gccttggctt cccactgtgg ggaggtctca cagaaaaatc tctgtttcag      3660
     tgaaattccg agttgtttct gtggacatca gttttcgccc attgaatgaa acggtgagtc      3720
     tcctgttggt gggtgagaaa tgagaatgag tgtttacaat gagaaaagta aacaaatagc      3780
     taagtctgat ttttttagga aacctgagct c                                     3811
//