spacer

EBI Dbfetch

ID   U04952; SV 1; linear; mRNA; STD; MUS; 1338 BP.
XX
AC   U04952;
XX
DT   15-JAN-1994 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus C57Bl/6N opioid receptor-like protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1338
RA   Yasuda K., Jones E., Reisine T., Bell G.I.;
RT   "Sequence of a mouse opioid receptor-like cDNA expressed in brain";
RL   Unpublished.
XX
RN   [2]
RP   1-1338
RA   Bell G.I.;
RT   ;
RL   Submitted (09-JAN-1994) to the INSDC.
RL   Graeme I. Bell, Howard Hughes Medical Institute, University of Chicago,
RL   5841 S. Maryland Ave., Chicago, IL 60637, USA
XX
DR   MD5; 7ae98afa360bc37579b0870480ea9805.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1338
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl/6N"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="Clontech Number ML1036a"
FT                   /clone="lambda mop2"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             169..1272
FT                   /codon_start=1
FT                   /product="opioid receptor-like protein"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAA03730.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
XX
SQ   Sequence 1338 BP; 252 A; 369 C; 353 G; 364 T; 0 other;
     gaattcggag ccggagcaga ccccaagcta gagtgagaag cattactcag ttcattgtgc        60
     tcctgcctgc ctttctgcta agcattaggg tctgttttgg cccagcttct gaagaggttg       120
     tgtgtgctgt tggaggaact gtactgagtg gctttgcagg gtgacagcat ggagtccctc       180
     tttcctgccc cattctggga ggtcttgtat ggcagccact ttcaagggaa cctgtctctc       240
     ctaaatgaga ccgtacccca tcacctgctc ctcaatgcta gccacagtgc cttcctgccc       300
     cttggactca aggtcaccat cgtggggctc tacttggctg tgtgcatcgg ggggctcctg       360
     gggaactgcc tcgtcatgta tgtcatcctc aggcacacca agatgaagac tgctaccaac       420
     atttacatat ttaatctggc actggctgat accctggtct tgctgacact gcccttccag       480
     ggcacagaca tccttctggg cttctggcca tttgggaatg cactgtgcaa gacggtcatt       540
     gctatcgact actacaacat gtttaccagc actttcactt tgactgccat gagtgtagac       600
     cgttatgtag ctatctgcca ccctatccgt gcccttgatg ttcggacatc cagtaaagcc       660
     caggccgtta atgtggccat atgggccctg gcttcggtgg ttggtgttcc tgttgccatc       720
     atgggctcag cacaagtgga ggatgaagag atcgagtgcc tggtggagat ccccgcccct       780
     caggactatt ggggccctgt atttgccatc tgcatcttcc ttttttcctt catcatcccg       840
     gttctgatca tctctgtctg ctacagcctc atgattcgac gacttcgtgg tgtccggctg       900
     ctttcaggct cccgagagaa ggaccggaac ctgcgacgca tcacacggct ggtactggta       960
     gttgtggctg tgtttgtggg ctgctggaca cctgtgcagg tctttgtcct ggttcaagga      1020
     ctgggtgttc agccaggtag tgagactgca gtagccattc tgcgcttctg cacagccctg      1080
     ggctatgtca acagttgtct caatcccatt ctctatgctt tcttggatga gaacttcaag      1140
     gcctgcttta gaaagttctg ctgtgcttct gccctgcacc gggagatgca ggtttctgat      1200
     cgtgtgcgca gcattgccaa ggatgtaggc cttggttgca agacctctga gacagtacca      1260
     cggccggcat gactaggcgt ggacctgccc atggtgcctg tcagtccaca gagcccatct      1320
     acacccaaca cggagctc                                                    1338
//


spacer
spacer