Dbfetch

ID   U04899; SV 1; linear; mRNA; STD; HUM; 1915 BP.
XX
AC   U04899;
XX
DT   04-FEB-1994 (Rel. 38, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Human orphan hormone nuclear receptor RORalpha3 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   9-1915
RX   PUBMED; 7926749.
RA   Giguere V., Tini M., Flock G., Ong E., Evans R.M., Otulakowski G.;
RT   "Isoform-specific amino-terminal domains dictate DNA-binding properties of
RT   ROR alpha, a novel family of orphan hormone nuclear receptors";
RL   Genes Dev. 8(5):538-553(1994).
XX
RN   [2]
RP   1-1915
RA   Giguere V.;
RT   ;
RL   Submitted (06-JAN-1994) to the INSDC.
RL   Vincent Giguere, Endocrine Research, Research Institute, Hospital for Sick
RL   Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada
XX
DR   MD5; 8bb7461c8b11207bdbce4994c3f661c2.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1915
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda gt11 from CloneTech"
FT                   /clone="lambdahT19"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..78
FT   CDS             79..1725
FT                   /codon_start=1
FT                   /product="RORalpha3"
FT                   /db_xref="GOA:P35398"
FT                   /db_xref="H-InvDB:HIT000217574.13"
FT                   /db_xref="HGNC:HGNC:10258"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="PDB:1N83"
FT                   /db_xref="PDB:1S0X"
FT                   /db_xref="PDB:4S15"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35398"
FT                   /protein_id="AAA62660.1"
FT                   /translation="MNEGAPGDSDLETEARVPWSIMGHCLRTGQARMSATPTPAGEGAR
FT                   SSSTCSSLSRLFWSQLEHINWDGATAKNFINLREFFSFLLPALRKAQIEIIPCKICGDK
FT                   SSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGM
FT                   SRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELH
FT                   DDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPY
FT                   CSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQ
FT                   REVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDS
FT                   QNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADR
FT                   SWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFK
FT                   AIYPDIVRLHFPPLYKELFTSEFEPAMQIDG"
FT   3'UTR           1726..1915
FT   regulatory      1891..1895
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1915 BP; 592 A; 428 C; 442 G; 453 T; 0 other;
     gaattcgggg actccatagt acactggggc aaagcacagc cccagtttct ggaggcagat        60
     gggtaaccag gaaaaggcat gaatgagggg gccccaggag acagtgactt agagactgag       120
     gcaagagtgc cgtggtcaat catgggtcat tgtcttcgaa ctggacaggc cagaatgtct       180
     gccacaccca cacctgcagg tgaaggagcc agaagctctt caacctgtag ctccctgagc       240
     aggctgttct ggtctcaact tgagcacata aactgggatg gagccacagc caagaacttt       300
     attaatttaa gggagttctt ctcttttctg ctccctgcat tgagaaaagc tcaaattgaa       360
     attattccat gcaagatctg tggagacaaa tcatcaggaa tccattatgg tgtcattaca       420
     tgtgaaggct gcaagggctt tttcaggaga agtcagcaaa gcaatgccac ctactcctgt       480
     cctcgtcaga agaactgttt gattgatcga accagtagaa accgctgcca acactgtcga       540
     ttacagaaat gccttgccgt agggatgtct cgagatgctg taaaatttgg ccgaatgtca       600
     aaaaagcaga gagacagctt gtatgcagaa gtacagaaac accggatgca gcagcagcag       660
     cgcgaccacc agcagcagcc tggagaggct gagccgctga cgcccaccta caacatctcg       720
     gccaacgggc tgacggaact tcacgacgac ctcagtaact acattgacgg gcacacccct       780
     gaggggagta aggcagactc cgccgtcagc agcttctacc tggacataca gccttcccca       840
     gaccagtcag gtcttgatat caatggaatc aaaccagaac caatatgtga ctacacacca       900
     gcatcaggct tctttcccta ctgttcgttc accaacggcg agacttcccc aactgtgtcc       960
     atggcagaat tagaacacct tgcacagaat atatctaaat cgcatctgga aacctgccaa      1020
     tacttgagag aagagctcca gcagataacg tggcagacct ttttacagga agaaattgag      1080
     aactatcaaa acaagcagcg ggaggtgatg tggcaattgt gtgccatcaa aattacagaa      1140
     gctatacagt atgtggtgga gtttgccaaa cgcattgatg gatttatgga actgtgtcaa      1200
     aatgatcaaa ttgtgcttct aaaagcaggt tctctagagg tggtgtttat cagaatgtgc      1260
     cgtgcctttg actctcagaa caacaccgtg tactttgatg ggaagtatgc cagccccgac      1320
     gtcttcaaat ccttaggttg tgaagacttt attagctttg tgtttgaatt tggaaagagt      1380
     ttatgttcta tgcacctgac tgaagatgaa attgcattat tttctgcatt tgtactgatg      1440
     tcagcagatc gctcatggct gcaagaaaag gtaaaaattg aaaaactgca acagaaaatt      1500
     cagctagctc ttcaacacgt cctacagaag aatcaccgag aagatggaat actaacaaag      1560
     ttaatatgca aggtgtctac attaagagcc ttatgtggac gacatacaga aaagctaatg      1620
     gcatttaaag caatataccc agacattgtg cgacttcatt ttcctccatt atacaaggag      1680
     ttgttcactt cagaatttga gccagcaatg caaattgatg ggtaaatgtt atcacctaag      1740
     cacttctaga atgtctgaag tacaaacatg aaaaacaaac aaaaaaatta accgagacac      1800
     tttatatggc cctgcacaga cctggagcgc cacacactgc acatcttttg gtgatcgggg      1860
     tcaggcaaag gaggggaaac aatgaaaaca aataaagttg aacttgtttt tctca           1915
//