spacer

EBI Dbfetch

ID   U04898; SV 1; linear; mRNA; STD; HUM; 1950 BP.
XX
AC   U04898;
XX
DT   04-FEB-1994 (Rel. 38, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Human orphan hormone nuclear receptor RORalpha2 mRNA,  complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1950
RX   PUBMED; 7926749.
RA   Giguere V., Tini M., Flock G., Ong E., Evans R.M., Otulakowski G.;
RT   "Isoform-specific amino-terminal domains dictate DNA-binding properties of
RT   ROR alpha, a novel family of orphan hormone nuclear receptors";
RL   Genes Dev. 8(5):538-553(1994).
XX
RN   [2]
RP   1-1950
RA   Giguere V.;
RT   ;
RL   Submitted (06-JAN-1994) to the INSDC.
RL   Vincent Giguere, Endocrine Research, Research Institute, Hospital for Sick
RL   Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada
XX
DR   MD5; 00e85e987b942b850667a3d06fabb157.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000309157; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
DR   Ensembl-Tr; ENST00000449337; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1950
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda gt11 human testis from CloneTech"
FT                   /clone="lambdahT3"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..89
FT   CDS             90..1760
FT                   /codon_start=1
FT                   /product="RORalpha2"
FT                   /db_xref="GOA:P35398"
FT                   /db_xref="H-InvDB:HIT000217573.14"
FT                   /db_xref="HGNC:HGNC:10258"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="PDB:1N83"
FT                   /db_xref="PDB:1S0X"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35398"
FT                   /protein_id="AAA62659.1"
FT                   /translation="MNEGAPGDSDLETEARVPWSIMGHCLRTGQARMSATPTPAGEGAR
FT                   RDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNAQIEII
FT                   PCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRL
FT                   QKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNIS
FT                   ANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYT
FT                   PASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEE
FT                   IENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFI
FT                   RMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSA
FT                   FVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRH
FT                   TEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG"
FT   3'UTR           1761..1950
FT   polyA_signal    1929..1934
XX
SQ   Sequence 1950 BP; 604 A; 431 C; 450 G; 465 T; 0 other;
     ccatctgtct gatcaccttg gactccatag tacactgggg caaagcacag ccccagtttc        60
     tggaggcaga tgggtaacca ggaaaaggca tgaatgaggg ggccccagga gacagtgact       120
     tagagactga ggcaagagtg ccgtggtcaa tcatgggtca ttgtcttcga actggacagg       180
     ccagaatgtc tgccacaccc acacctgcag gtgaaggagc cagaagggat gaactttttg       240
     ggattctcca aatactccat cagtgtatcc tgtcttcagg tgatgctttt gttcttactg       300
     gcgtctgttg ttcctggagg cagaatggca agccaccata ttcacaaaag gaagataagg       360
     aagtacaaac tggatacatg aatgctcaaa ttgaaattat tccatgcaag atctgtggag       420
     acaaatcatc aggaatccat tatggtgtca ttacatgtga aggctgcaag ggctttttca       480
     ggagaagtca gcaaagcaat gccacctact cctgtcctcg tcagaagaac tgtttgattg       540
     atcgaaccag tagaaaccgc tgccaacact gtcgattaca gaaatgcctt gccgtaggga       600
     tgtctcgaga tgctgtaaaa tttggccgaa tgtcaaaaaa gcagagagac agcttgtatg       660
     cagaagtaca gaaacaccgg atgcagcagc agcagcgcga ccaccagcag cagcctggag       720
     aggctgagcc gctgacgccc acctacaaca tctcggccaa cgggctgacg gaacttcacg       780
     acgacctcag taactacatt gacgggcaca cccctgaggg gagtaaggca gactccgccg       840
     tcagcagctt ctacctggac atacagcctt ccccagacca gtcaggtctt gatatcaatg       900
     gaatcaaacc agaaccaata tgtgactaca caccagcatc aggcttcttt ccctactgtt       960
     cgttcaccaa cggcgagact tccccaactg tgtccatggc agaattagaa caccttgcac      1020
     agaatatatc taaatcgcat ctggaaacct gccaatactt gagagaagag ctccagcaga      1080
     taacgtggca gaccttttta caggaagaaa ttgagaacta tcaaaacaag cagcgggagg      1140
     tgatgtggca attgtgtgcc atcaaaatta cagaagctat acagtatgtg gtggagtttg      1200
     ccaaacgcat tgatggattt atggaactgt gtcaaaatga tcaaattgtg cttctaaaag      1260
     caggttctct agaggtggtg tttatcagaa tgtgccgtgc ctttgactct cagaacaaca      1320
     ccgtgtactt tgatgggaag tatgccagcc ccgacgtctt caaatcctta ggttgtgaag      1380
     actttattag ctttgtgttt gaatttggaa agagtttatg ttctatgcac ctgactgaag      1440
     atgaaattgc attattttct gcatttgtac tgatgtcagc agatcgctca tggctgcaag      1500
     aaaaggtaaa aattgaaaaa ctgcaacaga aaattcagct agctcttcaa cacgtcctac      1560
     agaagaatca ccgagaagat ggaatactaa caaagttaat atgcaaggtg tctacattaa      1620
     gagccttatg tggacgacat acagaaaagc taatggcatt taaagcaata tacccagaca      1680
     ttgtgcgact tcattttcct ccattataca aggagttgtt cacttcagaa tttgagccag      1740
     caatgcaaat tgatgggtaa atgttatcac ctaagcactt ctagaatgtc tgaagtacaa      1800
     acatgaaaaa caaacaaaaa aattaaccga gacactttat atggccctgc acagacctgg      1860
     agcgccacac actgcacatc ttttggtgat cggggtcagg caaaggaggg gaaacaatga      1920
     aaacaaataa agttgaactt gtttttctca                                       1950
//


spacer
spacer