Dbfetch

ID   U04897; SV 1; linear; mRNA; STD; HUM; 1863 BP.
XX
AC   U04897;
XX
DT   04-FEB-1994 (Rel. 38, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 6)
XX
DE   Human orphan hormone nuclear receptor RORalpha1 mRNA,  complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1773
RX   PUBMED; 7926749.
RA   Giguere V., Tini M., Flock G., Ong E., Evans R.M., Otulakowski G.;
RT   "Isoform-specific amino-terminal domains dictate DNA-binding properties of
RT   ROR alpha, a novel family of orphan hormone nuclear receptors";
RL   Genes Dev. 8(5):538-553(1994).
XX
RN   [2]
RP   1-1863
RA   Giguere V.;
RT   ;
RL   Submitted (06-JAN-1994) to the INSDC.
RL   Vincent Giguere, Endocrine Research, Research Institute, Hospital for Sick
RL   Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada
XX
DR   MD5; cb96f9087e39b8a378d5c4c828964152.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
DR   EuropePMC; PMC218766; 14530391.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1863
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="lamda gt11 from J. Nathans"
FT                   /clone="lambda hR5"
FT                   /tissue_type="retina"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..101
FT   CDS             102..1673
FT                   /codon_start=1
FT                   /product="RORalpha1"
FT                   /db_xref="GOA:P35398"
FT                   /db_xref="H-InvDB:HIT000217572.13"
FT                   /db_xref="HGNC:HGNC:10258"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="PDB:1N83"
FT                   /db_xref="PDB:1S0X"
FT                   /db_xref="PDB:4S15"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35398"
FT                   /protein_id="AAA62658.1"
FT                   /translation="MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPV
FT                   RRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSN
FT                   ATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKH
FT                   RMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFY
FT                   LDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNIS
FT                   KSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKR
FT                   IDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDF
FT                   ISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQ
FT                   KNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEP
FT                   AMQIDG"
FT   3'UTR           1674..1863
FT   regulatory      1839..1844
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1863 BP; 571 A; 436 C; 428 G; 428 T; 0 other;
     gttttttttt tttttttggt accatagagt tgctctgaaa acagaagata gagggagtct        60
     cggagctcgc atctccagcg atctctacat tgggaaaaaa catggagtca gctccggcag       120
     cccccgaccc cgccgccagc gagccaggca gcagcggcgc ggacgcggcc gccggctcca       180
     gggagacccc gctgaaccag gaatccgccc gcaagagcga gccgcctgcc ccggtgcgca       240
     gacagagcta ttccagcacc agcagaggta tctcagtaac gaagaagaca catacatctc       300
     aaattgaaat tattccatgc aagatctgtg gagacaaatc atcaggaatc cattatggtg       360
     tcattacatg tgaaggctgc aagggctttt tcaggagaag tcagcaaagc aatgccacct       420
     actcctgtcc tcgtcagaag aactgtttga ttgatcgaac cagtagaaac cgctgccaac       480
     actgtcgatt acagaaatgc cttgccgtag ggatgtctcg agatgctgta aaatttggcc       540
     gaatgtcaaa aaagcagaga gacagcttgt atgcagaagt acagaaacac cggatgcagc       600
     agcagcagcg cgaccaccag cagcagcctg gagaggctga gccgctgacg cccacctaca       660
     acatctcggc caacgggctg acggaacttc acgacgacct cagtaactac attgacgggc       720
     acacccctga ggggagtaag gcagactccg ccgtcagcag cttctacctg gacatacagc       780
     cttccccaga ccagtcaggt cttgatatca atggaatcaa accagaacca atatgtgact       840
     acacaccagc atcaggcttc tttccctact gttcgttcac caacggcgag acttccccaa       900
     ctgtgtccat ggcagaatta gaacaccttg cacagaatat atctaaatcg catctggaaa       960
     cctgccaata cttgagagaa gagctccagc agataacgtg gcagaccttt ttacaggaag      1020
     aaattgagaa ctatcaaaac aagcagcggg aggtgatgtg gcaattgtgt gccatcaaaa      1080
     ttacagaagc tatacagtat gtggtggagt ttgccaaacg cattgatgga tttatggaac      1140
     tgtgtcaaaa tgatcaaatt gtgcttctaa aagcaggttc tctagaggtg gtgtttatca      1200
     gaatgtgccg tgcctttgac tctcagaaca acaccgtgta ctttgatggg aagtatgcca      1260
     gccccgacgt cttcaaatcc ttaggttgtg aagactttat tagctttgtg tttgaatttg      1320
     gaaagagttt atgttctatg cacctgactg aagatgaaat tgcattattt tctgcatttg      1380
     tactgatgtc agcagatcgc tcatggctgc aagaaaaggt aaaaattgaa aaactgcaac      1440
     agaaaattca gctagctctt caacacgtcc tacagaagaa tcaccgagaa gatggaatac      1500
     taacaaagtt aatatgcaag gtgtctacat taagagcctt atgtggacga catacagaaa      1560
     agctaatggc atttaaagca atatacccag acattgtgcg acttcatttt cctccattat      1620
     acaaggagtt gttcacttca gaatttgagc cagcaatgca aattgatggg taaatgttat      1680
     cacctaagca cttctagaat gtctgaagta caaacatgaa aaacaaacaa aaaaattaac      1740
     cgagacactt tatatggccc tgcacagacc tggagcgcca cacactgcac atcttttggt      1800
     gatcggggtc aggcaaagga ggggaaacaa tgaaaacaaa taaagttgaa cttgtttttc      1860
     tca                                                                    1863
//