Dbfetch

ID   U02971; SV 1; linear; mRNA; STD; MUS; 392 BP.
XX
AC   U02971;
XX
DT   15-JAN-1994 (Rel. 38, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Mus musculus BALB/c 2-oxoglutarate dehydrogenase E1 component mRNA, partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-392
RX   DOI; 10.1073/pnas.90.23.11272.
RX   PUBMED; 8248240.
RA   Udaka K., Tsomides T.J., Walden P., Fukusen N., Eisen H.N.;
RT   "A ubiquitous protein is the source of naturally occurring peptides that
RT   are recognized by a CD8+ T-cell clone";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(23):11272-11276(1993).
XX
RN   [2]
RP   1-392
RA   Udaka K.;
RT   ;
RL   Submitted (28-OCT-1993) to the INSDC.
RL   Keiko Udaka, Abteilung Immungenetik, Max-Planck-Institut fuer Biologie,
RL   Corrensstr. 42, Tuebingen 72076, Germany
XX
DR   MD5; 03a5e287e1114b42d378fe81186b83da.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018020; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017993; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017957; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017961; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017774; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018413; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017336; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017749; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017859; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017851; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017930; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018453; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017390; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027975; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027945; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027906; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027924; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027722; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028424; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027327; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027651; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027778; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027765; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027893; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027747; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028452; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027024; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027232; mus_musculus_wsbeij.
DR   EuropePMC; PMC47964; 8248240.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..392
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /haplotype="H-2d"
FT                   /cell_line="SP2/0"
FT                   /cell_type="myeloma"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>392
FT                   /codon_start=1
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /note="Corresponds to nucleotide 2546 to 2937 of human
FT                   2-oxoglutarate dehydrogenase cDNA sequence published in
FT                   Koike,K. et al. 1992. Proc. Natl. Acad. Sci. USA
FT                   89:1963-1967"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="AAC52130.1"
FT                   /translation="VVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFD
FT                   EMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQ
FT                   LSPFPFDLLLKEAQKYPNAELAWCQE"
FT   misc_feature    336..349
FT                   /note="encodes a naturally processed peptide recognized by
FT                   a CD8+ T-cell clone as a part of an alloantigen"
XX
SQ   Sequence 392 BP; 98 A; 116 C; 96 G; 82 T; 0 other;
     gttgtcaact gttccacccc tggcaacttc ttccatgtgc tgcgacgaca gatcttgctg        60
     cccttccgga agccgttaat cgtcttcact cccaaatccc tcctgcgcca ccctgaggca       120
     agaactagct ttgacgagat gctgccagga acgcacttcc agcgtgtgat cccagaaaat       180
     ggacctgcag ctcaggaccc acacaaagtc aagagacttc tcttctgcac tgggaaggtg       240
     tactatgacc tcacccgaga gcgcaaagcc aggaacatgg aggaggaggt ggctattaca       300
     aggattgagc agctatcacc attccccttt gacctcctgc tgaaagaggc acagaagtat       360
     cccaatgctg agctggcctg gtgccaggaa ga                                     392
//