spacer

EBI Dbfetch

ID   U01841; SV 1; linear; mRNA; STD; MUS; 2130 BP.
XX
AC   U01841;
XX
DT   06-MAY-1994 (Rel. 39, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus B6/CBAF1J peroxisome proliferator activated receptor gamma
DE   (ppar) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2130
RX   PUBMED; 8262913.
RA   Zhu Y., Alvares K., Huang Q., Rao M.S., Reddy J.K.;
RT   "Cloning of a new member of the peroxisome proliferator-activated receptor
RT   gene family from mouse liver";
RL   J Biol Chem 268(36):26817-26820(1993).
XX
RN   [2]
RP   1-2130
RA   Reddy J.K.;
RT   ;
RL   Submitted (15-SEP-1993) to the INSDC.
RL   J.K. Reddy, Northwestern University Medical School, Pathology, 303 E
RL   Chicago Ave, Chicago, IL 60611, USA
XX
DR   MD5; 9e34b1df22cb010844e2883fee808c9e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2130
FT                   /organism="Mus musculus"
FT                   /strain="B6/CBAF1J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda zap Stratagene Cat# 935302"
FT                   /clone="mpparg"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             491..1918
FT                   /codon_start=1
FT                   /gene="ppar"
FT                   /standard_name="PPAR"
FT                   /product="peroxisome proliferator activated receptor gamma"
FT                   /function="ligand induced activation of peroxisomal
FT                   beta-oxidation system"
FT                   /db_xref="GOA:P37238"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37238"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC52134.1"
FT                   /translation="MVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISA
FT                   PHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSL
FT                   MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYC
FT                   RFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIK
FT                   SFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQ
FT                   GCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLIS
FT                   EGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLL
FT                   NVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTE
FT                   TDMSLHPLLQEIYKDLY"
FT   polyA_signal    2098..2103
XX
SQ   Sequence 2130 BP; 590 A; 532 C; 531 G; 477 T; 0 other;
     ggcctcaccc tgggcaccgc ccccggtccg gccgggtggc tcggctcggc tcctccggtc        60
     cgcggccggc caggcggggc ccgtcgcact cagagcggca gccgcctggg gcgctcgggt       120
     cgggtcggcc gcaccgacgc acagcacccg ccaagccgcc gcctcaggtc agagtcgccc       180
     cgggccacgc ggcccgccgg agggacgcgg aagaagagac ctggggcgct gcctggggta       240
     ttgggtcgcg cgcagcctga ggggaccgag tgtgacgaca aggtgaccgg gctgagggga       300
     cgggctgagg agaagtcaca ctctgacagg agcctgtgag accaacagcc tgacgggtct       360
     cggttgaggg gacgcggctg agaaatcacg ttctgacagg actgtgtgac agacaagatt       420
     tgaaagaagc ggtgaaccac tgatattcag gacattttta aaaacaagac taccctttac       480
     tgaaattacc atggttgaca cagagatgcc attctggccc accaacttcg gaatcagctc       540
     tgtggacctc tccgtgatgg aagaccactc gcattccttt gacatcaagc cctttaccac       600
     agttgatttc tccagcattt ctgctccaca ctatgaagac attccattca caagagctga       660
     cccaatggtt gctgattaca aatatgacct gaagctccaa gaataccaaa gtgcgatcaa       720
     agtagaacct gcatctccac cttattattc tgaaaagacc cagctctaca acaggcctca       780
     tgaagaacct tctaactccc tcatggccat tgagtgccga gtctgtgggg ataaagcatc       840
     aggcttccac tatggagttc atgcttgtga aggatgcaag ggttttttcc gaagaaccat       900
     ccgattgaag cttatttatg ataggtgtga tcttaactgc cggatccaca aaaaaagtag       960
     aaataaatgt cagtactgtc ggtttcagaa gtgccttgct gtggggatgt ctcacaatgc      1020
     catcaggttt gggcggatgc cacaggccga gaaggagaag ctgttggcgg agatctccag      1080
     tgatatcgac cagctgaacc cagagtctgc tgatctgcga gccctggcaa agcatttgta      1140
     tgactcatac ataaagtcct tcccgctgac caaagccaag gcgagggcga tcttgacagg      1200
     aaagacaacg gacaaatcac catttgtcat ctacgacatg aattccttaa tgatgggaga      1260
     agataaaatc aagttcaaac atatcacccc cctgcaggag cagagcaaag aggtggccat      1320
     ccgaattttt caagggtgcc agtttcgatc cgtagaagcc gtgcaagaga tcacagagta      1380
     tgccaaaaat atccctggtt tcattaacct tgatttgaat gaccaagtga ctctgctcaa      1440
     gtatggtgtc catgagatca tctacacgat gctggcctcc ctgatgaata aagatggagt      1500
     cctcatctca gagggccaag gattcatgac cagggagttc ctcaaaaacc tgcggaagcc      1560
     ctttggtgac tttatggagc ctaagtttga gtttgctgtg aagttcaatg cactggaatt      1620
     agatgacagt gacttggcta tatttatagc tgtcattatt ctcagtggag accgcccagg      1680
     cttgctgaac gtgaagccca tcgaggacat ccaagacaac ctgctgcagg ccctggaact      1740
     gcagctcaag ctgaatcacc cagagtcctc tcagctgttc gccaaggtgc tccagaagat      1800
     gacagacctc aggcagatcg tcacagagca cgtgcagcta ctgcatgtga tcaagaagac      1860
     agagacagac atgagccttc accccctgct ccaggagatc tacaaggact tgtattagca      1920
     ggaaagtccc acccgctgac aacgtgttcc ttctattgat tgcactatta ttttgaggga      1980
     aaaaaatctg acacctaaga aatttactgt gaaaaagcat ttaaaaacaa aagttttaga      2040
     agatgatcta ttttatgcat attgtttata aagatacatt tacaatttac ttttaatatt      2100
     aaaaattacc acattaaaaa aaaaaaaaaa                                       2130
//


spacer
spacer