spacer

EBI Dbfetch

ID   U01665; SV 1; linear; mRNA; STD; MUS; 503 BP.
XX
AC   U01665;
XX
DT   23-NOV-1993 (Rel. 37, Created)
DT   13-AUG-2010 (Rel. 105, Last updated, Version 6)
XX
DE   Mus musculus BALB/c NUC1 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-503
RA   Chen F., Law S.W., O'Malley B.W.;
RT   "Identification of two mRNA related receptors and evidence for the
RT   existence of five subfamily members";
RL   Unpublished.
XX
RN   [2]
RP   1-503
RA   Chen F.;
RT   ;
RL   Submitted (13-SEP-1993) to the INSDC.
RL   Fang Chen, Department of Cell Biology, Baylor College of Medicine, Houston,
RL   TX 77030 USA
XX
DR   MD5; cd2d684729b6aafb7ce1d7606ea60b20.
DR   Ensembl-Gn; ENSMUSG00000002250; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002320; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..503
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="neonatal"
FT                   /clone_lib="Lambda UNI-ZAP"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             30..>503
FT                   /codon_start=1
FT                   /product="NUC1"
FT                   /note="secretory protein; homologue to rabbit uteroglobin"
FT                   /db_xref="GOA:P35396"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003075"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:101884"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35396"
FT                   /protein_id="AAA03332.1"
FT                   /translation="MTRPAAATQVGSVMEQPQEETPEAREEEKEEVAMGDGAPELNGGP
FT                   EHTLPSSSCADLSQNSSPSSLLDQLQMGCDGASGGSLNMECRVCGDKASGFHYGVHACE
FT                   GCKGFFRRTIRMKLEYEKCDRICKIQKKNRNKCQYCRFQKCLALGMSHNAIRFG"
FT   misc_feature    73..137
FT                   /note="DNA binding domain"
XX
SQ   Sequence 503 BP; 112 A; 147 C; 163 G; 81 T; 0 other;
     tgcgctcaga cccagatggt ggcagagcta tgaccaggcc tgcagcggcc acgcaagtgg        60
     ggtcagtcat ggaacagcca caggaggaga cccctgaggc ccgggaagag gagaaagagg       120
     aagtggccat gggtgacgga gccccggagc tcaatggggg accagaacac acgcttcctt       180
     ccagcagctg tgcagacctc tcccagaatt cctccccttc ctccctgctg gaccagctgc       240
     agatgggctg tgatggggcc tcaggcggca gcctcaacat ggaatgtcgg gtgtgcgggg       300
     acaaggcctc gggcttccac tacggggtcc acgcgtgcga ggggtgcaag ggcttcttcc       360
     gccggacaat ccgcatgaag ctcgagtatg agaagtgcga tcggatctgc aagatccaga       420
     agaagaaccg caacaagtgt cagtactgcc gcttccagaa gtgcctggca ctcggcatgt       480
     cgcacaacgc catccgcttt ggc                                               503
//


spacer
spacer