Dbfetch

ID   U01664; SV 1; linear; mRNA; STD; MUS; 1800 BP.
XX
AC   U01664;
XX
DT   23-NOV-1993 (Rel. 37, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus PPAR gamma mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1800
RX   DOI; 10.1006/bbrc.1993.2302.
RX   PUBMED; 8240342.
RA   Chen F., Law S.W., O'Malley B.W.;
RT   "Identification of two mPPAR related receptors and evidence for the
RT   existence of five subfamily members";
RL   Biochem. Biophys. Res. Commun. 196(2):671-677(1993).
XX
RN   [2]
RP   1-1800
RA   Chen F.;
RT   ;
RL   Submitted (13-SEP-1993) to the INSDC.
RL   Fang Chen, Department of Cell Biology, Baylor College of Medicine, Houston,
RL   TX 77030, USA
XX
DR   MD5; f2a5dc5eeab0328433058394d38e0f7f.
XX
CC   On Feb 7, 1995 this sequence version replaced gi:403940.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   misc_feature    108..172
FT                   /note="DNA binding domain"
FT   CDS             168..1595
FT                   /codon_start=1
FT                   /product="PPAR gamma"
FT                   /note="secretory protein; homologue to rabbit uteroglobin"
FT                   /db_xref="GOA:P37238"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37238"
FT                   /protein_id="AAA62110.1"
FT                   /translation="MVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISA
FT                   PHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSL
FT                   MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYC
FT                   RFQKCLAVGMSHNAIRFGRDRQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIK
FT                   SFPLTKAKARAILTGKTTDKSPFVIYDMSSFMMGEDKIKFKHITPLQEQSKEVAIRIFQ
FT                   GCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLIS
FT                   EGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLL
FT                   NVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTE
FT                   TDMSLHPLFQEIYKDLY"
FT   polyA_site      1800
FT                   /note="8 A nucleotides"
XX
SQ   Sequence 1800 BP; 531 A; 416 C; 412 G; 441 T; 0 other;
     ggaattccgc cggaggacgc ggaagaagag acctggggcg ctgcgctggg gtattgggtc        60
     gcgcgcagcc tgaggggacc gagtgtgacg acaagatttg aaagaagcgg tgaaccactg       120
     atatcaggac atttttaaaa acaagactac cctttactga aattaccatg gttgacacag       180
     agatgccatt ctggcccacc aacttcggaa tcagctctgt ggacctctcc gtgatggaag       240
     accactcgca ttcctttgac atcaagccct ttaccacagt tgatttctcc agcatttctg       300
     ctccacacta tgaagacatt ccattcacaa gagctgaccc aatggttgct gattacaaat       360
     atgacctgaa gctccaagaa taccaaagtg cgatcaaagt agaacctgca tctccacctt       420
     attattctga aaagacccag ctctacaaca ggcctcatga agaaccttct aactccctca       480
     tggccattga gtgccgagtc tgtggggata aagcatcagg cttccactat ggagttcatg       540
     cttgtgaagg atgcaagggt tttttccgaa gaaccatccg attgaagctt atttatgata       600
     ggtgtgatct taactgccgg atccacaaaa aaagtagaaa taaatgtcag tactgtcggt       660
     ttcagaagtg ccttgctgtg gggatgtctc acaatgccat caggtttggg cgggatcgac       720
     aggccgagaa ggagaagctg ttggcggaga tctccagtga tatcgaccag ctgaacccag       780
     agtctgctga tctgcgagcc ctggcaaagc atttgtatga ctcatacata aagtccttcc       840
     cgctgaccaa agccaaggcg agggcgatct tgacaggaaa gacaacggac aaatcaccat       900
     ttgtcatcta cgacatgagt tcctttatga tgggagaaga taaaatcaag ttcaaacata       960
     tcacccccct gcaggagcag agcaaagagg tggccatccg aatttttcaa gggtgccagt      1020
     ttcgatccgt agaagccgtg caagagatca cagagtatgc caaaaatatc cctggtttca      1080
     ttaaccttga tttgaatgac caagtgactc tgctcaagta tggtgtccat gagatcatct      1140
     acacgatgct ggcctccctg atgaataaag atggagtcct catctcagag ggccaaggat      1200
     tcatgaccag ggagttcctc aaaagcctgc ggaagccctt tggtgacttt atggagccta      1260
     agtttgagtt tgctgtgaag ttcaatgcac tggaattaga tgacagtgac ttggctatat      1320
     ttatagctgt cattattctc agtggagacc gcccaggctt gctgaacgtg aagcccatcg      1380
     aggacatcca agacaacctg ctgcaggccc tggaactgca gctcaagctg aatcacccag      1440
     agtcctctca gctgttcgcc aaggtgctcc agaagatgac agacctcagg cagatcgtca      1500
     cagagcacgt gcagctactg catgtgatca agaagacaga gacagacatg agccttcacc      1560
     ccctgttcca ggagatctac aaggacttgt attagcagga aagtcccacc cgctgacaac      1620
     gtgttccttc tattgattgc actattattt tgagggaaaa aaaatctgac acctaagaaa      1680
     atttactgtg aaaaaagcat ttaaaaaaca aaaaagtttt agaacatgat ctattttatg      1740
     catattgttt attaaaagat acatttacaa ttacttttaa tattaaaaat taccacatta      1800
//