Dbfetch

ID   AH005042; SV 2; linear; genomic DNA; STD; ROD; 2345 BP.
XX
AC   AH005042; S83178; S83180;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   29-JUL-2016 (Rel. 129, Last updated, Version 2)
XX
DE   Mus sp. adrenal hypoplasia congenita with hypogonadotropic hypogonadism
DE   homolog gene/nuclear hormone receptor (DAX-1) gene, complete cds.
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus.
XX
RN   [1]
RP   1-2345
RX   DOI; 10.1210/en.137.9.3921.
RX   PUBMED; 8756567.
RA   Bae D.S., Schaefer M.L., Partan B.W., Muglia L.;
RT   "Characterization of the mouse DAX-1 gene reveals evolutionary conservation
RT   of a unique amino-terminal motif and widespread expression in mouse
RT   tissue";
RL   Endocrinology 137(9):3921-3927(1996).
XX
DR   MD5; d88917f80264a5ddbeba935f15b423e4.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:1836096,
CC   gi:1836097, gi:1836099.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2345
FT                   /organism="Mus sp."
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10095"
FT   mRNA            join(285..1469,1588..>1832)
FT   gene            296..1832
FT                   /gene="DAX-1"
FT                   /note="adrenal hypoplasia congenita with hypogonadotropic
FT                   hypogonadism homolog gene/nuclear hormone receptor"
FT   CDS             join(296..1469,1588..1832)
FT                   /codon_start=1
FT                   /gene="DAX-1"
FT                   /note="adrenal hypoplasia congenita with hypogonadotropic
FT                   hypogonadism homolog gene/nuclear hormone receptor"
FT                   /protein_id="AAB46875.1"
FT                   /translation="MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGA
FT                   QPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAP
FT                   CWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSRE
FT                   APEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSA
FT                   DQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILP
FT                   LDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQA
FT                   TEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCV
FT                   KYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAV
FT                   SMDDMMLEMLCAKL"
FT   gap             1479..1578
FT                   /estimated_length=unknown
XX
SQ   Sequence 2345 BP; 532 A; 584 C; 621 G; 508 T; 100 other;
     catgctagct cttctcttcc ccaggtagag gcaggagggg tggagtgaag aaggaaaggt        60
     ggtatgtggt atgctagttc cagtgctgag actctccctt ggatttccag cttctaggga       120
     gtgtttgccc ctttgagctt tcgaggtcat ggccacacac attcaagcac aaaggcgcgt       180
     ccccctctgc gcccttgtcc aagaggagga ggcggacgcg cttgcgtgcg cattcagtat       240
     aaataagtcc caagcggcgg ccactgggca gaacgagcta caggagcctc aggccatggc       300
     gggtgaggac cacccgtggc agggcagcat cctctacaat ctactgatga gcgcgaagca       360
     gaagcacgcg tctcaggaag agcgagaggt gcgcttgggg gctcagtgct ggggttgcgc       420
     ctgcggtgct cagcccgtcc tgggtgggga gagactgtcc ggcgggcaag ccaggtccct       480
     cttgtaccgc tgctgctttt gtggggagaa tcacccgcgc cagggtggca tcctctactc       540
     tatgctcacc aacgccaggc agccaagcgt ggcgacccag gcgccgaggg cacgattcgg       600
     agcaccttgc tggggctgcg cctgcggcag cgcagagccc ctggtgggca gagaggggct       660
     gccggctggc caggccccct cgctcctgta ccgctgctgc ttctgcggag aagagcaccc       720
     gaggcagggc agcatcttat acagcttgct cactagcgct cagcaaacgc acgtgtctcg       780
     ggaagcaccc gaggcacatc gcagaggcga gtggtggcag ctgtcctact gtacccagag       840
     tgtgggtggc ccagaggggc tgcagagcac acaggccatg gcgttcctgt accgcagcta       900
     tgtgtgcggt gaagagcagc cccagcagat cagcgttgcc tctggcacgc ccgtgagcgc       960
     agaccaaaca ccagcgaccc cgcaagagca gccgagggct ccctggtggg acgcctcacc      1020
     tggtgtgcag cgtctgatca cactcaagga tccacaggtg gtgtgcgagg cagcgtccgc      1080
     tggcctgttg aagaccctgc gctttgtcaa gtacttgccc tgcttccaga tcctgcccct      1140
     agatcagcag ctggtgctgg tgcggagctg ttgggcgccc ctactcatgc ttgagttggc      1200
     ccaagatcac ctgcacttcg agatgatgga gatcccggag accaacacga cgcaggaaat      1260
     gcttaccacc aggcggcagg agaccgaagg tccagagcct gcagagcccc aggccacaga      1320
     gcagccacag atggtgtccg cggaggctgg gcacttgctc ccagctgctg cggtccaggc      1380
     catcaagagt ttctttttca agtgctggag tctgaacatt gacaccaaag agtatgccta      1440
     tctgaaaggg accgtgctct ttaacccagg taagcattnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnntc ctttcagacc tgcctggcct gcagtgcgtg aaatacattg      1620
     agggtcttca gtggagaacc cagcagatcc ttactgagca catccggatg atgcagagag      1680
     agtaccagat cagatccgct gaactgaaca gtgccctttt cctgctgaga ttcatcaata      1740
     gcgatgtcgt cactgaactc tttttcaggc ccatcattgg tgcagtcagc atggatgata      1800
     tgatgctgga gatgctctgt gcaaagctgt gaaggcatat gtccactcaa gtgcatttta      1860
     ctatagatgg agaaagcggt cgtagctgta ggcagaagag tgctaaaatt tgtgaaacca      1920
     aactttcttg tatttttaca tgcatagtat atttgtattc aattgaagaa atactttagt      1980
     tacaatgtaa aaatccctct gctccatact ggcttcttgt gaaggaaagc atttgcaaac      2040
     aaatcactat ttctgtatat ctctaagagt gtggtactag gctaacaagc taatttcata      2100
     aaaataacat ctctttccat taaccccgcc aaataaaatt tataatatta acttttaata      2160
     aaatttaagg tactaaccgt taaacggact ggagagtttt cttggggttt acagcttcaa      2220
     atactttcaa atctagctaa aataactgaa gatacaatcg tgagtaactt catggaattt      2280
     aatgctacgt atgtcactgg ttaaaaaaaa aaaaggttat tttgcctggc ttcactgctt      2340
     ccatt                                                                  2345
//