spacer

EBI Dbfetch

ID   S83180; SV 1; linear; genomic DNA; STD; ROD; 767 BP.
XX
AC   S83180;
XX
DT   14-FEB-1997 (Rel. 50, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 3)
XX
DE   DAX-1=adrenal hypoplasia congenita with hypogonadotropic hypogonadism
DE   homolog gene/nuclear hormone receptor [mice, 129Sv, Genomic, 767 nt,
DE   segment 2 of 2].
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 179662] from the original journal article.
RP   1-767
RX   DOI; 10.1210/en.137.9.3921.
RX   PUBMED; 8756567.
RA   Bae D.S., Schaefer M.L., Partan B.W., Muglia L.;
RT   "Characterization of the mouse DAX-1 gene reveals evolutionary conservation
RT   of a unique amino-terminal motif and widespread expression in mouse
RT   tissue";
RL   Endocrinology 137(9):3921-3927(1996).
XX
DR   MD5; 427d2398f96a0bba072a399d203d5d30.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..767
FT                   /organism="Mus sp."
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10095"
FT   gene            order(S83178.1:296..1478,1..254)
FT                   /gene="DAX-1"
FT                   /note="adrenal hypoplasia congenita with hypogonadotropic
FT                   hypogonadism homolog gene/nuclear hormone receptor"
FT   mRNA            join(S83178.1:285..1469,10..>254)
FT   CDS             join(S83178.1:296..1469,10..254)
FT                   /codon_start=1
FT                   /gene="DAX-1"
FT                   /note="adrenal hypoplasia congenita with hypogonadotropic
FT                   hypogonadism homolog gene/nuclear hormone receptor"
FT                   /db_xref="GOA:Q61066"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR025900"
FT                   /db_xref="MGI:MGI:1352460"
FT                   /db_xref="PDB:3F5C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61066"
FT                   /protein_id="AAB46875.1"
FT                   /translation="MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGA
FT                   QPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAP
FT                   CWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSRE
FT                   APEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSA
FT                   DQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILP
FT                   LDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQA
FT                   TEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCV
FT                   KYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAV
FT                   SMDDMMLEMLCAKL"
XX
SQ   Sequence 767 BP; 237 A; 147 C; 148 G; 235 T; 0 other;
     tcctttcaga cctgcctggc ctgcagtgcg tgaaatacat tgagggtctt cagtggagaa        60
     cccagcagat ccttactgag cacatccgga tgatgcagag agagtaccag atcagatccg       120
     ctgaactgaa cagtgccctt ttcctgctga gattcatcaa tagcgatgtc gtcactgaac       180
     tctttttcag gcccatcatt ggtgcagtca gcatggatga tatgatgctg gagatgctct       240
     gtgcaaagct gtgaaggcat atgtccactc aagtgcattt tactatagat ggagaaagcg       300
     gtcgtagctg taggcagaag agtgctaaaa tttgtgaaac caaactttct tgtattttta       360
     catgcatagt atatttgtat tcaattgaag aaatacttta gttacaatgt aaaaatccct       420
     ctgctccata ctggcttctt gtgaaggaaa gcatttgcaa acaaatcact atttctgtat       480
     atctctaaga gtgtggtact aggctaacaa gctaatttca taaaaataac atctctttcc       540
     attaaccccg ccaaataaaa tttataatat taacttttaa taaaatttaa ggtactaacc       600
     gttaaacgga ctggagagtt ttcttggggt ttacagcttc aaatactttc aaatctagct       660
     aaaataactg aagatacaat cgtgagtaac ttcatggaat ttaatgctac gtatgtcact       720
     ggttaaaaaa aaaaaaggtt attttgcctg gcttcactgc ttccatt                     767
//


spacer
spacer