Dbfetch

ID   S70244; SV 1; linear; mRNA; STD; ROD; 1613 BP.
XX
AC   S70244;
XX
DT   27-SEP-1994 (Rel. 41, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 3)
XX
DE   Apoj=apolipoprotein J [mice, C57BL/6XCBA, liver, mRNA, 1613 nt].
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 148165] from the original journal article.
RP   1-1613
RX   PUBMED; 8169523.
RA   Jordan-Starck T.C., Lund S.D., Witte D.P., Aronow B.J., Ley C.A.,
RA   Stuart W.D., Swertfeger D.K., Clayton L.R., Sells S.F., Paigen B.et., al;
RT   "Mouse apolipoprotein J: characterization of a gene implicated in
RT   atherosclerosis";
RL   J. Lipid Res. 35(2):194-210(1994).
XX
DR   MD5; 0d426cecf0ca78e537782a32fc914ffe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1613
FT                   /organism="Mus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10095"
FT   gene            1..1613
FT                   /gene="Apoj"
FT                   /note="apolipoprotein J, apoJ"
FT   CDS             28..1374
FT                   /codon_start=1
FT                   /gene="Apoj"
FT                   /product="apolipoprotein J"
FT                   /note="apoJ"
FT                   /db_xref="GOA:Q06890"
FT                   /db_xref="InterPro:IPR000753"
FT                   /db_xref="InterPro:IPR016014"
FT                   /db_xref="InterPro:IPR016015"
FT                   /db_xref="InterPro:IPR016016"
FT                   /db_xref="InterPro:IPR033986"
FT                   /db_xref="MGI:MGI:88423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06890"
FT                   /protein_id="AAB30623.1"
FT                   /translation="MKILLLCVAMLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEI
FT                   QNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNET
FT                   MMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLE
FT                   SDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKS
FT                   RLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDR
FT                   TVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQY
FT                   KELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPS
FT                   RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE"
XX
SQ   Sequence 1613 BP; 410 A; 459 C; 417 G; 327 T; 0 other;
     ggctccagtc tccaaggagg ccacgccatg aagattctcc tgctgtgcgt ggccatgctg        60
     ctgatctggg acaatggcat ggtcctggga gagcaggagg tctctgacaa tgagctccaa       120
     gaactgtcca ctcaagggag taggtatatt aataaggaga ttcagaacgc cgtccaggga       180
     gtgaagcaca taaaaactct catagaaaaa accaacgcag agcgcaagtc cttgctcaac       240
     agtttagagg aagccaagaa gaagaaagag gatgctctgg aggacactag ggattctgaa       300
     atgaagctga aggcattccc ggaagtgtgt aacgagacca tgatggccct ctgggaggag       360
     tgcaagccct gcctgaagca tacctgcatg aagttctatg cacgtgtctg caggagcggc       420
     tcagggctgg tcggccagca gctagaggag tttctaaacc agagctcacc cttctacttc       480
     tggatgaacg gcgaccgcat cgactccctg ctggagagtg accggcagca gagccaagtc       540
     ctggatgcca tgcaggacag ctttgctcgg gcatctggca tcatagacac gctctttcag       600
     gaccggttct tcgcccgtga gcttcatgac ccccactact tctcccccat cggcttccca       660
     cacaagaggc ctcatttctt atatcccaag tcccgcttgg tccgcagcct catgtctccc       720
     tcccactatg ggcctccgag cttccacaac atgttccagc ctttctttga gatgatccac       780
     caggctcaac aggccatgga tgtccagctc cacagcccag ccttccagtt cccagacgtg       840
     gatttcttaa gagaaggtga agatgaccgc actgtgtgca aggagatccg ccgcaactcc       900
     acaggatgcc tgaagatgaa gggccagtgt gaaaagtgcc aggagatctt gtctgtggac       960
     tgttcaacca acaatcctgc ccaggctaac ctgcgccagg agctgaacga ctcgctccag      1020
     gtggccgaga ggctgacaga gcagtacaag gagctgctgc agtccttcca gtcgaagatg      1080
     ctcaacacct catccctgct ggagcagctg aacgaccagt tcaactgggt gtcccagctg      1140
     gctaacctca cacagggcga agacaagtac taccttcggg tctccaccgt gaccacccat      1200
     tcctctgact cagaggtccc ctcccgtgtc actgaggtgg tggtgaagct gtttgactct      1260
     gaccccatca cagtggtgtt accagaagaa gtctctaagg ataaccctaa gtttatggac      1320
     acagtggcgg agaaggcgct acaggaatac cgcaggaaaa gccgtgcgga atgagataga      1380
     agcatcacct tcctatatgt aggagtgtct gggagggaat ctcccagctc cccgaggtgg      1440
     ctgcagaccc ctagagaact ccacatgtct ccaggcgagt aggcctcacc caagcagcct      1500
     gcccttcctc tggattctgt acactaatgc ctgcacttgc tgctctcggg aagaactgat      1560
     tcccccacgc aactaatcca ataaaagccg ccttgcgata aaaaaaaaaa aaa             1613
//