Dbfetch

ID   S67830; SV 1; linear; mRNA; STD; ROD; 3196 BP.
XX
AC   S67830;
XX
DT   16-MAR-1994 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   type IV collagenase=matrix metalloproteinase [mice, macrophage 32D C13
DE   cells, mRNA, 3196 nt].
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 140673] from the original journal article.
RP   1-3196
RX   PUBMED; 8219207.
RA   Graubert T., Johnston J., Berliner N.;
RT   "Cloning and expression of the cDNA encoding mouse neutrophil gelatinase:
RT   demonstration of coordinate secondary granule protein gene expression
RT   during terminal neutrophil maturation";
RL   Blood 82(10):3192-3197(1993).
XX
DR   MD5; 76287840229d6e041935b25c451266bb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3196
FT                   /organism="Mus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10095"
FT   gene            1..3196
FT                   /gene="type IV collagenase, gelatinase"
FT   CDS             48..2240
FT                   /codon_start=1
FT                   /gene="type IV collagenase, gelatinase"
FT                   /product="type IV collagenase"
FT                   /note="matrix metalloproteinase; gelatinase"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41245"
FT                   /protein_id="AAB28942.1"
FT                   /translation="MSPWQPLLLALLAFGCSSACPYQRHATFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPD
FT                   VGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPE
FT                   ADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYY
FT                   GNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHG
FT                   NGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGG
FT                   NSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVA
FT                   AHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTT
FT                   TEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTA
FT                   GSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTAR
FT                   TWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLL
FT                   PRRPGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHG
FT                   KFFWRVSFQNEVNKVDPEVNQVDDVGYVTYDLLQCP"
XX
SQ   Sequence 3196 BP; 708 A; 934 C; 821 G; 733 T; 0 other;
     ccaagaaagc agtagtagac gcggataaga agaaggggga actcaccatg agtccctggc        60
     agcccctgct cctggctctc ctggctttcg gctgcagctc tgcctgccct taccagcgcc       120
     acgcgacttt tgtggtcttc cccaaagacc tgaaaacctc caacctcacg gacacccagc       180
     tggcagaggc atacttgtac cgctatggtt acacccgggc cgcccagatg atgggagaga       240
     agcagtctct acggccggct ttgctgatgc ttcagaagca gctctccctg ccccagactg       300
     gtgagctgga cagccagaca ctaaaggcca ttcgaacacc acgctgtggt gtcccagacg       360
     tgggtcgatt ccaaaccttc aaaggcctca agtgggacca tcataacatc acatactgga       420
     tccaaaacta ctctgaagac ttgccgcgag acatgatcga tgacgccttc gcgcgcgcct       480
     tcgcggtgtg gggcgaggtg gcacccctca ccttcacccg cgtgtacgga cccgaagcgg       540
     acattgtcat ccagtttggt gtcgcggagc acggagacgg gtatcccttc gacggcaagg       600
     acggccttct ggcacacgcc tttccccctg gcgccggcgt tcagggagat gcccatttcg       660
     acgacgacga gttgtggtcg ctgggcaaag gcgtcgtgat ccccacttac tatggaaact       720
     caaatggtgc cccatgtcac tttcccttca ccttcgaggg acgctcctat tcggcctgca       780
     ccacagacgg ccgcaacgac ggcacgcctt ggtgtagcac aacagctgac tacgataagg       840
     acggcaaatt tggtttctgc cctagtgaga gactctacac agagcacggc aacggagaag       900
     gcaaaccctg tgtgttcccg ttcatctttg agggccgctc ctactctgcc tgcaccacta       960
     aaggccgctc ggatggttac cgctggtgcg ccaccacagc caactatgac caggataaac      1020
     tgtatggctt ctgccctacc cgagtggacg cgaccgtagt tgggggcaac tcggcaggag      1080
     agctgtgcgt cttccccttc gtcttcctgg gcaagcagta ctcttcctgt accagcgacg      1140
     gccgcaggga tgggcgcctc tggtgtgcga ccacatcgaa cttcgacact gacaagaagt      1200
     ggggtttctg tccagaccaa gggtacagcc tgttcctggt ggcagcgcac gagttcggcc      1260
     atgcactggg cttagatcat tccagcgtgc cggaagcgct catgtacccg ctgtatagct      1320
     acctcgaggg cttccctctg aataaagacg acatagacgg catccagtat ctgtatggtc      1380
     gtggctctaa gcctgaccca aggcctccag ccaccaccac aactgaacca cagccgacag      1440
     cacctcccac tatgtgtccc actatacctc ccacggccta tcccacagtg ggccccacgg      1500
     ttggccctac aggcgccccc tcacctggcc ccacaagcag cccgtcacct ggccctacag      1560
     gcgccccctc acctggccct acagcggccc ctactgcggg ctcttctgag gcctctacag      1620
     agtctttgag tccggcagac aatccttgca atgtggatgt ttttgatgct attgctgaga      1680
     tccagggcgc tctgcatttc ttcaaggacg gttggtactg gaagttcctg aatcatagag      1740
     gaagcccatt acagggcccc ttccttactg cccgcacgtg gccagccctg cctgcaacgc      1800
     tggactccgc ctttgaggat ccgcagacca agagggtttt cttcttctct ggacgtcaaa      1860
     tgtgggtgta cacaggcaag accgtgctgg gccccaggag tctggataag ttgggtctag      1920
     gcccagaggt aacccacgtc agcgggcttc tcccgcgtcg tcccgggaag gctctgctgt      1980
     tcagcaaggg gcgtgtctgg agattcgatt tgaagtctca gaaggtggat ccccagagcg      2040
     tcattcgcgt ggataaggag ttctctggtg tgccctggaa ctcacacgac atcttccagt      2100
     accaagacaa agcctatttc tgccatggca aattcttctg gcgtgtgagt ttccaaaatg      2160
     aggtgaacaa ggtggaccct gaggtgaacc aggtggacga cgtgggctac gtgacctacg      2220
     acctcctgca gtgcccttga actagggctc cttctttgct tcaaccgtgc agtgcaagtc      2280
     tctagagacc accaccacca ccaccacaca caaaccccat ccgagggaaa ggtgctagct      2340
     ggccaggtac agactggtga tctcttctag agactgggaa ggagtggagg caggcagggc      2400
     tctctctgcc caccgtcctt tcttgttgga ctgtttctaa taaacacgga tccccaacct      2460
     tttccagcta ctttagtcaa tcagcttatc tgtagttgca gatgcatccg agcaagaaga      2520
     caactttgta gggtggattc tgacctttta tttttgtgtg gcgtctgaga attgaatcag      2580
     ctggcttttg tgacaggcac ttcaccggct aaaccacctc tcccgactcc agccctttta      2640
     tttattatgt atgtggttat gttcacatgc atgtatttaa cccacagaat gcttactgtg      2700
     tgtcgggcgc ggctccaacc gctgcataaa tattaaggta ttcagttgcc cctactggaa      2760
     ggtattatgt aactatttct ctcttacatt ggagaacacc accgagctat ccactcatca      2820
     aacatttatt gagagcatcc ctagggagcc aggctctcta ctgggcgtta gggacagaaa      2880
     tgttggttct tccttcaagg attgctcaga gattctccgt gtcctgtaaa tctgctgaaa      2940
     ccagacccca gactcctctc tctcccgaga gtccaactca ctcactgtgg ttgctggcag      3000
     ctgcagcatg cgtatacagc atgtgtgcta gagaggtaga gggggtctgt gcgttatggt      3060
     tcaggtcaga ctgtgtcctc caggtgagat gacccctcag ctggaactgt accaggaagg      3120
     ataaccaagt gtcttcctgg cagtcttttt taaataaatg aataaatgaa tatttactta      3180
     ttaaaaaaaa aaaaaa                                                      3196
//