spacer

EBI Dbfetch

ID   S66181; SV 1; linear; mRNA; STD; ROD; 2203 BP.
XX
AC   S66181;
XX
DT   18-DEC-1993 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   delta opiate receptor [mice, NG108-15 hybrid cells, mRNA Partial, 2203 nt].
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 138618] from the original journal article. This sequence comes from
RC   Fig. 1. Map location: 4.
RP   1-2203
RX   DOI; 10.1073/pnas.90.20.9305.
RX   PUBMED; 8415697.
RA   Bzdega T., Chin H., Kim H., Jung H.H., Kozak C.A., Klee W.A.;
RT   "Regional expression and chromosomal localization of the delta opiate
RT   receptor gene";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(20):9305-9309(1993).
XX
DR   MD5; 6ea4ecfbc1ac8664c7dd0f54589fee0f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2203
FT                   /organism="Mus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10095"
FT   CDS             1..1098
FT                   /partial
FT                   /codon_start=1
FT                   /gene="delta opiate receptor"
FT                   /product="delta opiate receptor"
FT                   /note="This sequence comes from Fig. 1."
FT                   /db_xref="GOA:P32300"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000321"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97438"
FT                   /db_xref="PDB:4EJ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32300"
FT                   /protein_id="AAB28546.1"
FT                   /translation="RAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAI
FT                   TALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLM
FT                   ETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINI
FT                   CIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILII
FT                   TVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVD
FT                   INRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRR
FT                   PRQATTRERVTACTPSDGPGGGAAA"
XX
SQ   Sequence 2203 BP; 465 A; 641 C; 636 G; 461 T; 0 other;
     cgtgcggagc tgcagtcctc gcccctcgtc aacctctcgg acgcctttcc cagcgccttc        60
     cccagcgcgg gcgccaatgc gtcggggtcg ccgggagccc gtagtgcctc gtccctcgcc       120
     ctagccatcg ccatcaccgc gctctactcg gctgtgtgcg cagtggggct tctgggcaac       180
     gtgctcgtca tgtttggcat cgtccggtac accaaattga agaccgccac caacatctac       240
     atcttcaatc tggctttggc tgatgcgctg gccaccagca cgctgccctt ccagagcgcc       300
     aagtacttga tggaaacgtg gccgtttggc gagctgctgt gcaaggctgt gctctccatt       360
     gactactaca acatgttcac tagcatcttc accctcacca tgatgagcgt ggaccgctac       420
     attgctgtct gccatcctgt caaagccctg gacttccgga caccagccaa ggccaagctg       480
     atcaatatat gcatctgggt cttggcttca ggtgtcgggg tccccatcat ggtcatggca       540
     gtgacccaac cccgggatgg tgcagtggta tgcatgctcc agttccccag tcccagctgg       600
     tactgggaca ctgtgaccaa gatctgcgtg ttcctctttg ccttcgtggt gccgatcctc       660
     atcatcacgg tgtgctatgg cctcatgcta ctgcgcctgc gcagcgtgcg tctgctgtcc       720
     ggttccaagg agaaggaccg cagcctgcgg cgcatcacgc gcatggtgct ggtggtggtg       780
     ggcgccttcg tggtgtgctg ggcgcccatc cacatcttcg tcatcgtctg gacgctggtg       840
     gacatcaatc ggcgcgaccc acttgtggtg gccgcactgc acctgtgcat tgcgctgggc       900
     tacgccaaca gcagcctcaa cccggttctc tacgccttcc tggacgagaa cttcaagcgc       960
     tgcttccgcc agctctgtcg cacgccctgc ggccgccaag aacccggcag tctccgtcgt      1020
     ccccgccagg ccaccacgcg tgagcgtgtc actgcctgca ccccctccga cggcccgggc      1080
     ggtggcgctg ccgcctgacc tacccgacct tccccttaaa cgcccctccc aagtgaagtg      1140
     atccagaggc cacaccgagc tccctgggag gctgtggcca ccaccaggac agctagaatt      1200
     gggcctgcac agaggggagg cctcctgtgg ggacggggcc tgagggatca aaggctccag      1260
     gttggaacgg tgggggtgag gaagcagagc tggtgattcc taaactgtat ccattagtaa      1320
     ggcctctcca atgggacaga gcctccgcct tgagataaca tcgggttctg gcctttttga      1380
     acacccagct ccagtccaag acccaaggat tccagctcca ggaaccagga ggggcagtga      1440
     tggggtcgat gatttggttt ggctgagagt cccagcattt gtgttatggg gaggatctct      1500
     catcttagag aagataaggg gacagggcat tcaggcaagg cagcttgggg tttggtcagg      1560
     agataagcgc ccccttccct tggggggagg ataagtgggg gatggtcaac gttggagaag      1620
     agtcaaagtt ctcaccacct ttctaactac tcagctaaac tcgttgaggc tagggccaac      1680
     gtgacttctc tgtagagagg atacaagccg ggcctgatgg ggcaggcctg tgtaatccca      1740
     gtcatagtgg aggctgaggc tggaaaatta aggaccaaca gcctgggcaa tttagtgtct      1800
     caaaataaaa tgtaaagagg gctgggaatg tagctcagtg gtagggtgtt tgtgtgaggc      1860
     tctgggatca ataagacaaa acaaccaacc aaccaaaaac cttccaaaca acaaaaccaa      1920
     ccctcaaacc aaaaaactat gtgggtgtct ctgagtctgg tttgaagaga acccgcagcc      1980
     ctgtatccct gtggggctgt ggacagtggg cagaagcaga ggctccctgg atcctgaaca      2040
     agggccccaa aagcaagttc taaagggacc cctgaaaccg agtaagcctt tgtgtcaaga      2100
     agtgggagta gaaccagaaa ggtggctgag tgattaaggg cacgtgactc tcttgcagag      2160
     gacataggtt cgattcccag cacccacata gtggctcaca gcc                        2203
//


spacer
spacer