Dbfetch

ID   S65735; SV 1; linear; mRNA; STD; ROD; 1272 BP.
XX
AC   S65735;
XX
DT   26-NOV-1993 (Rel. 37, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 3)
XX
DE   membrane glycoprotein M6=major CNS myelin protein PLP/DM20 homolog {clone
DE   M6a} [mice, brain, mRNA, 1272 nt].
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 137972] from the original journal article.
RP   1-1272
RX   DOI; 10.1016/0896-6273(93)90147-J.
RX   PUBMED; 8398137.
RA   Yan Y., Lagenaur C., Narayanan V.;
RT   "Molecular cloning of M6: identification of a PLP/DM20 gene family";
RL   Neuron 11(3):423-431(1993).
XX
DR   MD5; 7dcfd444c4d9d69b5ae6b66f5e513d81.
DR   EuropePMC; PMC2954693; 21102985.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1272
FT                   /organism="Mus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10095"
FT   gene            1..1272
FT                   /gene="membrane glycoprotein M6"
FT   CDS             78..914
FT                   /codon_start=1
FT                   /gene="membrane glycoprotein M6"
FT                   /product="membrane glycoprotein M6"
FT                   /note="major CNS myelin protein PLP/DM20 homolog; Method:
FT                   conceptual translation with partial peptide sequencing"
FT                   /db_xref="GOA:P35802"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35802"
FT                   /protein_id="AAB28350.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
XX
SQ   Sequence 1272 BP; 321 A; 299 C; 288 G; 364 T; 0 other;
     aaggcacacg cttttttgac atctaattga gcttttgact aataccgtgc gccagattct        60
     cctgaagaaa ggtagccatg gaagagaata tggaagaagg acagacacag aaagggtgct       120
     tcgagtgctg cattaaatgc ctgggaggta ttccctatgc ttctctgatt gcaaccatcc       180
     tgctgtatgc aggcgttgcc ctgttctgtg gctgtggcca tgaagccctt tctggaacag       240
     tcaacattct gcagacctac tttgagttgg caaggactgc tggagacaca ctggatgttt       300
     tcactatgat tgacatcttt aagtatgtga tctatggcat tgcggctgct ttctttgtct       360
     atggcatttt actgatggta gaaggtttct tcacaactgg ggctatcaaa gatctctatg       420
     gagacttcaa aatcaccacc tgtggcagat gtgtgagcgc ttggtttatc atgctgacat       480
     acctcttcat gttggcctgg ctgggagtca cagctttcac ctcactgccc gtgtacatgt       540
     atttcaatgt gtggaccatc tgccggaaca ccactctagt ggagggagca aatctctgct       600
     tggatctgcg tcagtttggg attgtgacaa ttggagagga aaagaaaatt tgtactgcct       660
     ctgagaactt cctgaggatg tgtgaatcta ctgagctgaa tatgaccttc cacttgttca       720
     ttgtggcact tgctggagct ggagcagcag ttattgctat ggtccactac ctgatggttc       780
     tgtctgccaa ctgggcctat gtgaaagatg cctgccgcat gcagaagtac gaagacatca       840
     agtcaaagga agagcaggag ctgcacgaca tccattctac tcgctctaaa gagcggctca       900
     atgcgtacac ataaatacgc ttctctgttc cttaccactc gaaggcattg gtgtttcatt       960
     aagggccatc caaccatcca acctgtgaag agcaaaacga gatgctactc atcaaagatg      1020
     cgcagggtga ctaatgaatc acctgagtat aactctttgc tgttgagcat tccatcttct      1080
     aatttgttaa attggaatga ccaaatctcc tctacaagct cctattcagt ctttttttta      1140
     acctctcaaa ttgatttagt tcctctgtat gatcaaagat actaacattg tccggaattc      1200
     cccctcccca gccactagac cccaagtcca tcagtctaca taagtggggt ttcctctcca      1260
     acccacaggc cg                                                          1272
//