Dbfetch

ID   S65335; SV 1; linear; mRNA; STD; ROD; 1834 BP.
XX
AC   S65335;
XX
DT   05-JUL-1995 (Rel. 44, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus sp. delta opioid receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 137283] from the original journal article. This sequence comes from
RC   Fig. 1.
RP   1-1834
RX   PUBMED; 8397421.
RA   Keith D.E.Jr., Anton B., Evans C.J.;
RT   "Characterization and mapping of a delta opioid receptor clone from
RT   NG108-15 cells";
RL   Proc. West. Pharmacol. Soc. 36:299-306(1993).
XX
DR   MD5; 25513f0260a715abcc7a87b7655c4a6d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1834
FT                   /organism="Mus sp."
FT                   /mol_type="mRNA"
FT                   /cell_type="NG108-15"
FT                   /db_xref="taxon:10095"
FT   CDS             28..1146
FT                   /codon_start=1
FT                   /product="delta opioid receptor"
FT                   /note="DOR-1"
FT                   /db_xref="GOA:P32300"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000321"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97438"
FT                   /db_xref="PDB:4EJ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32300"
FT                   /protein_id="AAA16009.1"
FT                   /translation="MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASS
FT                   LALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPF
FT                   QSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPA
FT                   KAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAF
FT                   VVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFV
FT                   IVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQ
FT                   EPGSLRRPRQATTRERVTACTPSDGPGGGAAA"
XX
SQ   Sequence 1834 BP; 342 A; 563 C; 545 G; 384 T; 0 other;
     cacggtggag acggacacgg cggcgccatg gagctggtgc cctctgcccg tgcggagctg        60
     cagtcctcgc ccctcgtcaa cctctcggac gcctttccca gcgccttccc cagcgcgggc       120
     gccaatgcgt cggggtcgcc gggagcccgt agtgcctcgt ccctcgccct agccatcgcc       180
     atcaccgcgc tctactcggc tgtgtgcgca gtggggcttc tgggcaacgt gctcgtcatg       240
     tttggcatcg tccggtacac caaattgaag accgccacca acatctacat cttcaatctg       300
     gctttggctg atgcgctggc caccagcacg ctgcccttcc agagcgccaa gtacttgatg       360
     gaaacgtggc cgtttggcga gctgctgtgc aaggctgtgc tctccattga ctactacaac       420
     atgttcacta gcatcttcac cctcaccatg atgagcgtgg accgctacat tgctgtctgc       480
     catcctgtca aagccctgga cttccggaca ccagccaagg ccaagctgat caatatatgc       540
     atctgggtct tggcttcagg tgtcggggtc cccatcatgg tcatggcagt gacccaaccc       600
     cgggatggtg cagtggtatg catgctccag ttccccagtc ccagctggta ctgggacact       660
     gtgaccaaga tctgcgtgtt cctctttgcc ttcgtggtgc cgatcctcat catcacggtg       720
     tgctatggcc tcatgctact gcgcctgcgc agcgtgcgtc tgctgtccgg ttccaaggag       780
     aaggaccgca gcctgcggcg catcacgcgc atggtgctgg tggtggtggg cgccttcgtg       840
     gtgtgctggg cgcccatcca catcttcgtc atcgtctgga cgctggtgga catcaatcgg       900
     cgcgacccac ttgtggtggc cgcactgcac ctgtgcattg cgctgggcta cgccaacagc       960
     agcctcaacc cggttctcta cgccttcctg gacgagaact tcaagcgctg cttccgccag      1020
     ctctgtcgca cgccctgcgg ccgccaagaa cccggcagtc tccgtcgtcc ccgccaggcc      1080
     accacgcgtg agcgtgtcac tgcctgcacc ccctccgacg gcccgggcgg tggcgctgcc      1140
     gcctgaccta cccgaccttc cccttaaacg cccctcccaa gtgaagtgat ccagaggcca      1200
     caccgagctc cctgggaggc tgtggccacc accaggacag ctagaattgg gcctgcacag      1260
     aggggaggcc tcctgtgggg acggggcctg agggatcaaa ggctccaggt tggaacggtg      1320
     ggggtgagga agcagagctg gtgattccta aactgtatcc attagtaagg cctctccaat      1380
     gggacagagc ctccgccttg agataacatc gggttctggc ctttttgaac acccagctcc      1440
     agtccaagac ccaaggattc cagctccagg aaccaggagg ggcagtgatg gggtcgatga      1500
     tttggtttgg ctgagagtcc cagcatttgt gttatgggga ggatctctca tcttagagaa      1560
     gataagggga cagggcattc aggcaaggca gcttggggtt tggtcaggag ataagcgccc      1620
     ccttcccttg gggggaggat aagtggggga tggtcaacgt tggagaagag tcaaagttct      1680
     caccaccttt ctaactactc agctaaactc gttgaggcta gggccaacgt gacttctctg      1740
     tagagaggat acaagccggg cctgatgggg caggcctgtg taatcccagt catagtggag      1800
     gctgaggctg gaaaattaag gaccaacagc ccgg                                  1834
//