spacer

EBI Dbfetch

ID   S62288; SV 1; linear; mRNA; STD; ROD; 765 BP.
XX
AC   S62288;
XX
DT   18-AUG-1993 (Rel. 36, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   SmN=small nuclear ribonucleoprotein particles component/spliceosome
DE   tissue-specific component [mice, CD-1, heart, mRNA, 765 nt].
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 133632] from the original journal article.
RP   1-765
RX   DOI; 10.1006/jmcc.1993.1038.
RX   PUBMED; 8510173.
RA   Gerrelli D., Grimaldi K., Horn D., Mahadeva U., Sharpe N., Latchman D.S.;
RT   "The cardiac form of the tissue-specific SmN protein is identical to the
RT   brain and embryonic forms of the protein";
RL   J. Mol. Cell. Cardiol. 25(3):321-329(1993).
XX
DR   MD5; ae3bed46b77a15e9824fd0905c37c286.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..765
FT                   /organism="Mus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10095"
FT   gene            1..765
FT                   /gene="SmN"
FT   CDS             32..754
FT                   /codon_start=1
FT                   /gene="SmN"
FT                   /product="SmN"
FT                   /note="small nuclear ribonucleoprotein particles
FT                   component/spliceosome tissue-specific component"
FT                   /db_xref="GOA:P63163"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63163"
FT                   /protein_id="AAB27138.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
XX
SQ   Sequence 765 BP; 189 A; 209 C; 207 G; 160 T; 0 other;
     tgttgacaaa ggctattgtg gaacagcaat catgactgtg ggtaagagta gcaagatgct        60
     gcagcacatt gactatagga tgagatgtat cctgcaagat gggagaatct tcattggcac       120
     cttcaaggct tttgacaagc atatgaattt gatcctctgt gattgtgatg agttcaggaa       180
     gatcaagcca aagaatgcaa aacagccaga acgtgaagaa aaacgggttt tgggtctggt       240
     cttgctacgt ggggagaact tggtttcaat gacagtggag ggcccacctc ctaaagatac       300
     tggcattgct cgtgtgcctc ttgctggcgc tgcaggtggc cctggggttg gaagagcagc       360
     tggcagagga gtgccagcag gtgtacctat tccccaagct cctgctggat tagcaggccc       420
     tgtccgagga gttggaggcc catcccagca ggtcatgacc ccacagggaa gaggcactgt       480
     tgctgctgct gctgttgctg ctactgctag cattgcagga gccccaaccc agtacccgcc       540
     aggacgggga actccacctc cacctgtagg cagagcaacc ccacctccag gcattatggc       600
     tcctccacct ggaatgagac cacccatggg cccaccaatt ggacttcccc ctgctcgagg       660
     tacacctata ggcatgcctc ctccaggaat gagacccccc ccaccaggaa ttagaggccc       720
     acctccccca ggaatgcgtc caccaagacc ctaagataca gttga                       765
//


spacer
spacer