spacer

EBI Dbfetch

ID   S56490; SV 1; linear; genomic DNA; STD; MUS; 122 BP.
XX
AC   S56490;
XX
DT   30-NOV-1993 (Rel. 37, Created)
DT   20-JUN-2005 (Rel. 84, Last updated, Version 3)
XX
DE   Fas antigen {early transposable element ETn} [mice, MRL lpr/lpr, Transposon
DE   Mutant, 122 nt, segment 6 of 6].
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 126863] from the original journal article.
RP   1-122
RX   DOI; 10.1073/pnas.90.5.1756.
RX   PUBMED; 7680478.
RA   Adachi M., Watanabe-Fukunaga R., Nagata S.;
RT   "Aberrant transcription caused by the insertion of an early transposable
RT   element in an intron of the Fas antigen gene of lpr mice";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(5):1756-1760(1993).
XX
DR   MD5; 4f1ce411d986d1b4952bd6a8443115da.
DR   Ensembl-Gn; ENSMUSG00000024778; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025691; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..122
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(S56485.1:50..79,S56486.1:13..166,19..>122)
FT                   /codon_start=1
FT                   /product="Fas antigen"
FT                   /db_xref="GOA:P25446"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR008063"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:95484"
FT                   /db_xref="PDB:3OQ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25446"
FT                   /protein_id="AAB25700.1"
FT                   /translation="MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVHETDKNCS
FT                   EGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADK"
XX
SQ   Sequence 122 BP; 46 A; 20 C; 29 G; 27 T; 0 other;
     ttattttttt catgacaggt aaaaaaaaag ttgaggactg caaaatgaat gggggtacac        60
     caacctgtgc cccatgcaca gaagggaagg agtacatgga caagaaccat tatgctgata       120
     aa                                                                      122
//


spacer
spacer