Dbfetch

ID   AH004192; SV 2; linear; genomic DNA; STD; MUS; 1813 BP.
XX
AC   AH004192; S56485-S56490;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Mus musculus Fas antigen gene, partial cds; and transposon early
DE   transposable element ETn, complete sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1813
RX   DOI; 10.1073/pnas.90.5.1756.
RX   PUBMED; 7680478.
RA   Adachi M., Watanabe-Fukunaga R., Nagata S.;
RT   "Aberrant transcription caused by the insertion of an early transposable
RT   element in an intron of the Fas antigen gene of lpr mice";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(5):1756-1760(1993).
XX
DR   MD5; d2ad0081bf45106066cbb373e9403d62.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:298500,
CC   gi:298501, gi:298502, gi:298503, gi:298504, gi:298505, gi:1680523.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1813
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(50..79,204..357,1710..>1813)
FT                   /codon_start=1
FT                   /product="Fas antigen"
FT                   /protein_id="AAB25700.1"
FT                   /translation="MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVHETDKNCS
FT                   EGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADK"
FT   gap             92..191
FT                   /estimated_length=unknown
FT   gap             370..469
FT                   /estimated_length=unknown
FT   mobile_element  order(629..1035,1136..1292,1393..1401)
FT                   /mobile_element_type="transposon:early transposable element
FT                   ETn"
FT                   /note="inserted in intron 2"
FT   gap             1036..1135
FT                   /estimated_length=unknown
FT   gap             1293..1392
FT                   /estimated_length=unknown
FT   gap             1592..1691
FT                   /estimated_length=unknown
XX
SQ   Sequence 1813 BP; 317 A; 328 C; 296 G; 372 T; 500 other;
     gccgcaggct gcccacacag gccgcccgct gttttccctt gctgcagaca tgctgtggat        60
     ctgggctgtc ctgcctctgg taagctttgg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn ntctccttta caggtgcttg ctggctcaca gttaagagtt catactcaag       240
     gtactaatag catctccgag agtttaaagc tgaggaggcg ggttcatgaa actgataaaa       300
     actgctcaga aggattatat caaggaggcc cattttgctg tcaaccatgc caacctggta       360
     ggtcacatgn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt ttactaaaag       480
     gttacaaaag gtcacccata ttttcacttt actcattgac ttatcaagta aataattgtg       540
     cttcgtcagc aggaatccta tgaggtaatt caccaagccg tgccctagga aacacagcat       600
     agattccatt tgctgctgtg tccatgtgtg tagtctcccc tcccccagcc tgaaacctgc       660
     ttgctcgggg tggagcttcc tgctcattcg ttctgccacg cccactgctg gaacctgcgg       720
     agccacaccc gtgcaccttt ctactggacc agagattatt cggcgggaat cgggtcccct       780
     cccccttcct tcataactgg tgtcgcaaca ataaaatttg agccttgatc agagtaactg       840
     tcttggctac atttcttctt ttgccccgtc tagattcctc tcttacagct cgagcggcct       900
     tctcagtcga accgttcacg ttgcgagctg ctggcggccg caacattttg gcgcctgaac       960
     agggacctga agaatggcag agagatgcta agaggaacgc tgcattggag ctccacagga      1020
     aaggatcttc gtatcnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagttt      1140
     accataagaa aggttaaaga atcccagtga agcaagtttt ttctttagcc ctagattcca      1200
     ggcagaacta ttgagcatag ataattttcc cccctcaggc cagctttttc ctttttttta      1260
     ttttgttaat aatagggagg agatgtagtc tcnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nngccgcaac acatgtggag cagatttgac tgcgtttgtc atttgtattc      1440
     ctggctagag ttaattgtta gttacactgt taatgcctag atttgctagt tactgcatct      1500
     tgctacattt ccctgtacat ttgctgcact gagcccatta ctcactgacc ctagcttctg      1560
     gctgcaccgg ctgctgctta gcatctctgc cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1680
     nnnnnnnnnn nttatttttt tcatgacagg taaaaaaaaa gttgaggact gcaaaatgaa      1740
     tgggggtaca ccaacctgtg ccccatgcac agaagggaag gagtacatgg acaagaacca      1800
     ttatgctgat aaa                                                         1813
//