spacer

EBI Dbfetch

ID   S47225; SV 1; linear; mRNA; STD; ROD; 1509 BP.
XX
AC   S47225;
XX
DT   16-FEB-1993 (Rel. 34, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   antithrombin III [mice, B6/CBAF1J, liver, mRNA, 1509 nt].
XX
KW   .
XX
OS   Mus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 117254] from the original journal article.
RP   1-1509
RX   PUBMED; 1440494.
RA   Wu J.K., Sheffield W.P., Blajchman M.A.;
RT   "Molecular cloning and cell-free expression of mouse antithrombin III";
RL   Thromb. Haemost. 68(3):291-296(1992).
XX
DR   MD5; 8e36e1e4f820a2a5e9a13c7a8dcc2bf0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1509
FT                   /organism="Mus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10095"
FT   gene            1..1509
FT                   /gene="antithrombin III, AT-III"
FT   CDS             16..1413
FT                   /codon_start=1
FT                   /gene="antithrombin III, AT-III"
FT                   /product="antithrombin III"
FT                   /note="AT-III"
FT                   /db_xref="GOA:P32261"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR015555"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:88095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32261"
FT                   /protein_id="AAB23965.1"
FT                   /translation="MYSPGAGSGAAGERKLCLLSLLLIGALGCAICHGNPVDDICIAKP
FT                   RDIPVNPLCIYRSPGKKATEEDGSEQKVPEATNRRVWELSKANSRFATNFYQHLADSKN
FT                   DNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRL
FT                   YRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNW
FT                   VANKTEGRIKDVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKVDGQSCP
FT                   VPMMYQEGKFKYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEW
FT                   LDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSD
FT                   AFHKAFLEVNEEGSEAAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGR
FT                   VANPCVN"
XX
SQ   Sequence 1509 BP; 395 A; 400 C; 376 G; 338 T; 0 other;
     cttggagcat cggccatgta ttcccctggg gcaggaagtg gggctgctgg tgagaggaag        60
     ctttgtctcc tctctctgct cctcatcggt gccttgggct gtgctatctg tcacggaaac       120
     cctgtggacg acatctgcat agcgaagccc cgagacatcc ccgtgaatcc cttgtgcatt       180
     taccgctccc ctgggaagaa ggccaccgag gaggatggct cagagcagaa ggttccagaa       240
     gccaccaacc ggcgggtctg ggaactgtcc aaggccaatt cgcgatttgc cactaacttc       300
     taccagcacc tggcagactc caagaatgac aacgacaaca ttttcctgtc acccttgagc       360
     atctccactg cttttgctat gaccaagctg ggtgcctgta acgacactct caagcagctg       420
     atggaggttt ttaaatttga taccatctcc gagaagacat ccgaccagat ccacttcttc       480
     tttgccaaac tgaactgccg actctatcga aaagccaaca agtcctctga cttggtatca       540
     gccaaccgcc tttttggaga caaatccctc accttcaacg agagctatca agatgttagt       600
     gaggttgtct atggagccaa gctccagccc ctggacttca aggagaatcc ggagcaatcc       660
     agagtgacca tcaacaactg ggtagctaat aagactgaag gccgcatcaa agatgtcatc       720
     ccacagggcg ccattaacga gctcactgcc ctggttctgg ttaacaccat ttacttcaag       780
     ggcctgtgga agtcaaagtt cagccctgag aacacaagga aggaaccgtt ctataaggtc       840
     gatgggcagt catgcccagt gcctatgatg taccaggaag gcaaattcaa ataccggcgc       900
     gtggcagagg gcacccaggt gctagagctg cccttcaagg gggatgacat caccatggtg       960
     ctcatcctgc ccaagcctga gaagagcctg gccaaggtgg agcaggagct caccccagag      1020
     ctgctgcagg agtggctgga tgagctgtca gagactatgc ttgtggtcca catgccccgc      1080
     ttccgcaccg aggatggctt cagtctgaag gagcagctgc aagacatggg cctcattgat      1140
     ctcttcagcc ctgaaaagtc ccaactccca gggatcgttg ctggaggcag ggacgacctc      1200
     tatgtctccg acgcattcca caaagcattt cttgaggtaa atgaggaagg cagtgaagca      1260
     gcagcgagta cttctgtcgt gattactggc cggtcactga accccaatag ggtgaccttc      1320
     aaggccaaca ggcccttcct ggttcttata agggaagttg cactgaacac tattatattc      1380
     atggggagag tggctaatcc ttgtgtgaac taaaatattc ttaatctttg caccttttcc      1440
     tactttggtg tttgtgaata gaagtaaaaa taaatacgac tgccacctca aaaaaaaaaa      1500
     aaaaaaaaa                                                              1509
//


spacer
spacer