spacer

EBI Dbfetch

ID   S40304; SV 1; linear; mRNA; STD; MUS; 885 BP.
XX
AC   S40304;
XX
DT   16-FEB-1993 (Rel. 34, Created)
DT   21-SEP-2005 (Rel. 85, Last updated, Version 3)
XX
DE   Mus musculus SmN protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 108863] from the original journal article.
RP   1-885
RX   PUBMED; 1627828.
RA   Grimaldi K., Gerrelli D., Sharpe N.G., Lund T., Latchman D.S.;
RT   "The intronless mouse gene for the tissue specific splicing protein SmN is
RT   a processed pseudogene containing a stop codon after thirty-one amino
RT   acids";
RL   DNA Seq 2(4):241-246(1992).
XX
DR   MD5; a43eca8983831fcb301d411f463498e4.
DR   Ensembl-Gn; ENSMUSG00000000948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098402; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..885
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             155..877
FT                   /codon_start=1
FT                   /product="SmN protein"
FT                   /note="small ribonucleoprotein particle component"
FT                   /db_xref="GOA:Q3UN87"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UN87"
FT                   /protein_id="AAA09579.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
XX
SQ   Sequence 885 BP; 218 A; 236 C; 228 G; 203 T; 0 other;
     aaggaaaaca ggacccatcc tctgtctgtg aaatttggtc aagcttacat tgtttgttaa        60
     tagccctgca tcgaaccttt atttatatcc cttccccgag tattaaggat cttgaaattt       120
     tagtgttgac aacggctatt gtggaacagc aatcatgact gtgggtaaga gtagcaagat       180
     gctgcagcac attgactata ggatgagatg tatcctgcaa gatggaagga tcttcattgg       240
     caccttcaag gcttttgaca agcatatgaa tttgatcctc tgtgattgtg atgagttcag       300
     gaagatcaag ccaaagaatg caaaacagcc agaacgtgaa gaaaaacggg ttttgggtct       360
     ggtcttgcta cgtggggaga acttggtttc aatgactgtg gagggcccac ctcctaaaga       420
     tactggcatt gctcgtgtgc ctcttgctgg cgctgcaggt ggccctgggg ttggaagagc       480
     agctggcaga ggagtgccag caggtgtacc tattccccaa gctcctgctg gattagcagg       540
     ccctgtccga ggagttggag gcccatccca gcaggtcatg accccacagg gaagaggcac       600
     tgttgctgct gctgctgttg ctgctactgc tagcattgca ggagccccaa cccagtaccc       660
     gccaggacgg ggaactccac ctccacctgt aggcagagca accccacctc caggcattat       720
     ggctcctcca cctggtatga gaccacccat gggcccacca attggacttc cccctgctcg       780
     tgggacacct ataggcatgc ctcctccagg aatgagaccc cctccaccag gaattagagg       840
     cccacctccc ccaggaatgc gcccaccaag accctaagat acagt                       885
//


spacer
spacer