Dbfetch

ID   M96688; SV 1; linear; mRNA; STD; MUS; 3219 BP.
XX
AC   M96688;
XX
DT   17-NOV-1992 (Rel. 34, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus (clone MK6) murine potassium channel (MK1.6) mRNA, complete
DE   cds.
XX
KW   murine potassium channel protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3219
RA   Migeon M.B., Street V.A., Demas V.P., Tempel B.L.;
RT   "Cloning and characterization of MK1.6, a murine potassium channel gene";
RL   Epilepsy Res. 0:0-0(1992).
XX
DR   MD5; 4a2f22aa838c01edf5f36346d91bb246.
DR   Ensembl-Gn; ENSMUSG00000038077; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185333; mus_musculus.
DR   EuropePMC; PMC40472; 8524834.
DR   EuropePMC; PMC507338; 8647945.
DR   RFAM; RF00485; K_chan_RES.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3219
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="lambda-gt11"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             916..2505
FT                   /codon_start=1
FT                   /gene="MK1.6"
FT                   /product="murine potassium channel protein"
FT                   /db_xref="GOA:Q61923"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003972"
FT                   /db_xref="InterPro:IPR004053"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:96663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61923"
FT                   /protein_id="AAA39772.1"
FT                   /translation="MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVI
FT                   NISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGG
FT                   RLRRPVNVPLDIFMEEIRFYQLGEEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLL
FT                   FEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNEGSGTRLSPASRSH
FT                   EEEDEDEDSYAFPGSIPSGGLGTGGTSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVR
FT                   FSACPSKAAFFRNIMNIIDLVAIFPYFITLGTELVQRHEQQSVSGGSGQNGQQAMSLAI
FT                   LRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEA
FT                   DDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIV
FT                   SNFNYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRPSYLPTPH
FT                   RAYAEKRMLTEV"
XX
SQ   Sequence 3219 BP; 637 A; 867 C; 976 G; 739 T; 0 other;
     gggtgaatgt gagaaagcaa gaggcatgcc aggagagcgc gggaaagatt actggggagg        60
     caagtataca catctctccc cagcatccag gcttgctgca gcccctgact gggtaagggg       120
     tgtgatgtga gagtggggtg ggcagcaggc ggggcctgcc acgtcacttg gagagtgtgt       180
     taaggaggaa gggcagagct gagagctgag cctgctgctg ctgttgctgc tgctgctgct       240
     gctgctgctg ctgttgctgc tgctggggct gctgcgggtg caggcaaggc ttgaagcggt       300
     ggggaggtgg gtctccgcgc ttcggcgccc gggaaggccc agggcattcc gaggcctcta       360
     gaacagctag ctcctgggga agaaggtggc ggctgcaatc gcaccttggc cagacctagt       420
     tcggtggtgg acgtagggcg gaggcggagg ccgagcccgg gcaggagtct ttggtgagcc       480
     agagggaggc gcatctggcg cttaggtacc agcggcaacc cagagtcgtg tgcagctgga       540
     gaagcgcagt aggacctggt gagagccagc aggtctggag ggcggacctg tgggtcctga       600
     gcccagtttt aggcaccatc gagagctaag ccacgcgtct tttcgggcag ccagtttcac       660
     gcgcgcgaca gtttgcgggt tccaggcatc tcagaaatcc tgagcacgga ggcgcggcta       720
     ttgagagcca gagccacttc ccagacctag cctggcagag ggaccagctg cagggctcac       780
     cgacctaacc gccaggtcag agcacgggcc ccaccctaaa ggagggcaca gccgaagctg       840
     tgaagcgggt gccgctctct ggagctcgtg tcgtgggcgc cgtcctagtg gcggggagcg       900
     caccgccgag gtgacatgag atcggagaaa tccctgacgc tggcggcgcc gggggaggtc       960
     cgtgggccgg agggggagca acaggatgcg ggtgagttcc aggaggccga gggcggcggc      1020
     ggctgctgta gtagtgagag gttggtgatc aacatctccg ggctgcgctt cgagacgcag      1080
     ctgcgcaccc tgtcgctgtt ccctgacacg ctgctaggag accctggccg cagagtccgt      1140
     ttctttgacc ccttgaggaa cgagtacttc tttgaccgca accgacccag cttcgacgct      1200
     atcctttatt actatcaatc tggaggtcgc ctgcgcaggc ctgttaatgt gcccctggac      1260
     atttttatgg aagagatccg cttctatcag ttgggagagg aagccctggc ggccttccgg      1320
     gaggatgagg gttgcctgcc cgaaggtggc gaggatgaga aaccactccc ctcccagcct      1380
     ttccagcgac aggtctggct tctctttgag tacccggaga gttccgggcc cgcccgaggc      1440
     atcgccatcg tctcagtatt ggtcatcctc atctccatcg tcatcttttg cctggagacc      1500
     ttgcctcaat tccgtgcaga tgggcgcggt ggaagcaacg agggtagtgg gacccgcttg      1560
     tctccggcct ccaggagcca cgaggaagaa gatgaggatg aagattccta tgcatttcct      1620
     ggtagcattc cctctggggg gttggggact ggaggaacat cttcacttag tactctcggg      1680
     ggttctttct tcacagaccc cttcttcttg gtggaaactc tgtgtatcgt ctggttcacg      1740
     tttgagctcc tggtgcgctt ctctgcctgt cccagcaagg cggccttctt tcgcaatatc      1800
     atgaacatca ttgacttggt ggccattttc ccctacttta tcaccttggg caccgagcta      1860
     gtgcaacgtc acgagcagca gtctgtgagt ggtggcagtg gtcagaatgg gcagcaggcc      1920
     atgtccctag ccatcctcag ggtgatccgc ctggtccggg tgttccgaat cttcaagctc      1980
     tcccgccatt ccaaggggct gcagatcctg ggtaagacct tacaggcgtc catgcgggag      2040
     ctcgggctgc tcatcttctt cctcttcatc ggagtcatcc tcttttccag cgctgtctac      2100
     ttcgcagagg ctgatgatgt tgactcgctc ttccctagca tcccagatgc cttctggtgg      2160
     gctgtggtta caatgaccac ggtaggttat ggggacatgt accccatgac ggtagggggc      2220
     aagattgtgg gctcactgtg cgccattgct ggggtcctca ccattgcatt accggtaccg      2280
     gtcattgtct ccaatttcaa ctacttctac caccgagaga cggagcagga ggagcaaggc      2340
     cagtataccc acgtcacttg tgggcagccc actccggact tgaaggcaac ggacaatggg      2400
     cttggcaaac ctgactttgc cgaggcttca cgggaacgcc ggcccagcta ccttccgact      2460
     ccacatcgag cttatgcgga gaaaaggatg ctcaccgagg tttgatggat gcgggcaggc      2520
     ctgcaggaaa acaggagctc tgagcaagtc atctctcagg cttccttctc atgctcacta      2580
     cttccgcctt agctccagag gacctcgaac ccccctcccc cctaacacag tacatggcat      2640
     cttggaccaa atatctggac tgtagactgt tgctcgatcc tcgcagcatt cgaggtttct      2700
     ccatcttagt gacattttgg aaatttcaac ggtgccaccc aatcatgccc atcagtcacg      2760
     tggatgagat gcacgtttct gactgatctt ccctcaagac tgagttttca tgcctgggtc      2820
     ttgtaatatc tctaggaatg gtgacaccag tagaatagga agcagctaca ctcaggtccc      2880
     ttctttagtg tcctttgctt tgggtcatgc accttcctta cttagcttct ggtcacttgg      2940
     tcactggcag aatctggaga atggaaaaga tttcagcttg gcattttagt gcccaagcca      3000
     tcttctgact ggtagagcta ttagctgcac ggctttgaaa gatatggcta aatttggatg      3060
     gaattagaga aaatactacc caactggatt atttgaagga catgaaggtc agttttagac      3120
     caatgggggc cggtggattt ctctagttgt gatctgtcac aggagatgct ggcaggggtc      3180
     tacatcagtc ctcaccactc tgattccatg acttcctcc                             3219
//