Dbfetch

ID   M94538; SV 1; linear; mRNA; STD; MUS; 348 BP.
XX
AC   M94538;
XX
DT   04-JUN-1992 (Rel. 32, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 17)
XX
DE   Mus musculus cyclic nucleotide phosphodiesterase (CaM-PDE) mRNA, partial
DE   cds.
XX
KW   calcium/calmodulin-dependent phosphodiesterase;
KW   cyclic nucleotide phosphodiesterase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-348
RX   PUBMED; 1326532.
RA   Repaske D.R., Swinnen J.V., Jin S.-L.C., Van Wyk J.J., Conti M.;
RT   "A polymerase chain reaction strategy to identify and clone cyclic
RT   nucleotide phosphodiesterase cDNAs. Molecular cloning of the cDNA encoding
RT   the 63-kDa calmodulin-dependent phosphodiesterase";
RL   J Biol Chem 267(26):18683-18688(1992).
XX
DR   MD5; b46d57bb12a22c92e76289a4ba2541e3.
DR   Ensembl-Gn; ENSMUSG00000022489; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022444; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022406; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022381; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022410; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022177; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022859; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021703; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022277; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022253; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022346; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022275; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021443; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021753; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023132; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042878; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042843; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042809; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042832; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042567; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043315; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042667; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042635; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042595; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042578; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043355; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042251; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041955; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..348
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /isolate="S49"
FT                   /mol_type="mRNA"
FT                   /cell_line="K30a"
FT                   /cell_type="T-lymophocyte"
FT                   /tissue_type="lymphoma"
FT                   /db_xref="taxon:10090"
FT   primer_bind     complement(1..20)
FT                   /gene="CaM-PDE"
FT                   /note="degenerate PCR primer"
FT   CDS             1..348
FT                   /partial
FT                   /codon_start=1
FT                   /gene="CaM-PDE"
FT                   /standard_name="calmodulin-dependent phosphodiesterase"
FT                   /product="cyclic nucleotide phosphodiesterase"
FT                   /note="63 kDa protein"
FT                   /db_xref="GOA:Q01065"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013706"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="MGI:MGI:97523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01065"
FT                   /protein_id="AAA37367.1"
FT                   /translation="YHNRIHAADVTQTVHCFLLRTGMVHCLSEIEVLAIIFAAAIHDYE
FT                   HTGTTNSFHIQTKSECAILYNDRSVLENHHISSVFRMMQDDEMNIFINLTKDEFAELRA
FT                   LVIEMVLATDMS"
FT   primer_bind     332..348
FT                   /gene="CaM-PDE"
FT                   /note="degenerate PCR primer"
XX
SQ   Sequence 348 BP; 90 A; 93 C; 80 G; 85 T; 0 other;
     taccacaaca ggatccatgc agccgacgtg acccagactg tccattgctt ccttctccgc        60
     acaggcatgg tgcactgcct gtcagagatt gaggtcttgg ccatcatctt tgctgcagcc       120
     atccatgact atgagcacac aggcacaacc aacagcttcc acattcagac caagtcagaa       180
     tgtgccatcc tgtacaatga tcgatcggtg ctggagaatc accacatcag ctctgtcttt       240
     cgaatgatgc aggatgatga gatgaacatt tttatcaatc tcaccaagga tgaatttgca       300
     gagctgcggg ccctggttat cgagatggtg ttggctacag acatgtca                    348
//