Dbfetch

ID   M93275; SV 1; linear; mRNA; STD; MUS; 1680 BP.
XX
AC   M93275;
XX
DT   15-MAY-1992 (Rel. 31, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mouse adipose differentiation related protein (ADFP) mRNA, complete cds.
XX
KW   adipose differentiation-related protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1680
RX   DOI; 10.1073/pnas.89.17.7856.
RX   PUBMED; 1518805.
RA   Jiang H.-P., Serrero G.;
RT   "Isolation and characterization of a full-length cDNA coding for an adipose
RT   differentiation-related protein";
RL   Proc. Natl. Acad. Sci. U.S.A. 89(17):7856-7860(1992).
XX
DR   MD5; d0b4e838051d6b0d596ff04917c34844.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Gn; MGP_DBA2J_G0028227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027273; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
DR   Ensembl-Tr; MGP_DBA2J_T0065955; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065771; mus_musculus_pwkphj.
DR   EuropePMC; PMC114617; 11581411.
DR   EuropePMC; PMC17207; 11027337.
DR   EuropePMC; PMC2225983; 18039394.
DR   EuropePMC; PMC49813; 1518805.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1680
FT                   /organism="Mus musculus"
FT                   /strain="C3H"
FT                   /mol_type="mRNA"
FT                   /cell_line="1246"
FT                   /tissue_type="adipose"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..78
FT                   /note="putative"
FT   mRNA            1..1680
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             79..1356
FT                   /codon_start=1
FT                   /gene="ADFP"
FT                   /standard_name="ADRP"
FT                   /product="adipose differentiation related protein"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA37176.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSEMLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
FT   3'UTR           1357..1680
FT                   /note="putative"
FT   regulatory      1664..1669
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1680
XX
SQ   Sequence 1680 BP; 422 A; 413 C; 460 G; 385 T; 0 other;
     tagtggtgat ctggaccgtg cggacttgct cgtccctcag ctctcctgtt aggcgtctct        60
     tttctccagg aggaaaaaat ggcagcagca gtagtggatc cgcaacagag cgtggtgatg       120
     agagtggcca acctgccctt ggtgagctct acctacgacc ttgtgtcctc cgcttatgtc       180
     agtacaaagg atcagtaccc gtatttgaga tccgtgtgtg agatggccga gaagggcgtg       240
     aagaccgtga cctctgcggc catgacaagt gccctgccca tcatccagaa gctggagcca       300
     caaattgcgg ttgccaatac ctatgcctgc aaggggctag acaggatgga ggaaagactg       360
     cctattctga accagccaac gtccgagatt gttgccagtg ccagaggtgc cgtaactggg       420
     gcgaaggatg tggtgacgac taccatggct ggagccaagg attctgtagc cagcacagtc       480
     tcaggggtgg tggataagac caaaggagca gtgactggca gcgtggaaag gaccaagtct       540
     gtggtcaatg gcagcatcaa tacagttttg gggatggtgc agttcatgaa cagtggagta       600
     gataatgcca tcaccaagtc ggagatgctg gtagaccagt acttccctct cactcaggag       660
     gagctggaga tggaagcaaa aaaggtggaa ggatttgata tggttcagaa gccgagcaac       720
     tatgaacggc tggagtccct gtctaccaag ctctgctctc gggcttatca ccaggctctc       780
     agcagggtta aagaggccaa acaaaagagc caggagacca tttctcagct ccactccact       840
     gtccacctga ttgaattcgc caggaagaat atgcacagtg ccaaccagaa aattcagggt       900
     gctcaggata agctctatgt ctcgtgggtg gagtggaaga gaagcatcgg ctacgacgac       960
     accgatgagt cccactgtgt tgagcacatc gagtcacgta ctctggctat cgcccgcaac      1020
     ctgacccagc agctccagac tacatgccag actgtcctgg tcaacgccca agggttacca      1080
     cagaacattc aagatcaggc caaacacttg ggggtgatgg caggcgacat ctactccgta      1140
     ttccgcaatg ctgcctcctt taaggaagtg tccgatggcg tcctcacatc tagcaagggg      1200
     cagctgcaga aaatgaagga atccttagat gaagttatgg attactttgt taacaacacg      1260
     cctctcaact ggctggtagg tcccttttat cctcagtcta ccgaggtgaa caaggccagc      1320
     ctgaaggtcc agcagtctga ggtcaaagct cagtaaaccc ctccttgtca ccagagcatg      1380
     atgttgctgg ccagatgacc ccttttgctg tattgaaatt aacttggtag atggctttag      1440
     cttagaaaag cagcttctta gaaccaaggg cctcattatg gtcactcaca gctcagttat      1500
     ggtcttgccc cagctggccc tggcacagga gttctcttac ctggctggtg agtggcctgt      1560
     gttagtcttg tgaggacctg gaggaaccta aaagctcaga tgcacttaca gtcttgtctg      1620
     tggcctttgt attgttattg gctgtaaacg tctgtctgga ccgaataaag attcacgtga      1680
//