spacer

EBI Dbfetch

ID   M93264; SV 1; linear; mRNA; STD; MUS; 4674 BP.
XX
AC   M93264;
XX
DT   15-MAY-1992 (Rel. 31, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus alpha-2-macroglobulin mRNA, complete cds.
XX
KW   alpha-2-macroglobulin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4674
RX   DOI; 10.1111/j.1432-1033.1992.tb17424.x.
RX   PUBMED; 1280217.
RA   van Leuven F., Torrekens S., Overbergh L., Lorent K., de Strooper B.,
RA   van den Berghe H.;
RT   "The primary sequence and the subunit structure of mouse
RT   alpha-2-macroglobulin, deduced from protein sequencing of the isolated
RT   subunits and from molecular cloning of the cDNA";
RL   Eur. J. Biochem. 210(1):319-327(1992).
XX
DR   MD5; d0b2ca5a452cbabef3c8f84d84980c62.
DR   Ensembl-Gn; ENSMUSG00000030359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112132; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4674
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             50..4537
FT                   /codon_start=1
FT                   /product="alpha-2-macroglobulin"
FT                   /db_xref="GOA:Q61838"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR009048"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019565"
FT                   /db_xref="InterPro:IPR019742"
FT                   /db_xref="MGI:MGI:87854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61838"
FT                   /protein_id="AAA39508.1"
FT                   /translation="MRRNQLPTPAFLLLFLLLPRDATTATAKPQYVVLVPSEVYQESLK
FT                   RPCVSLNHVNETVMLSLTLEYAMQQTKLLTDQAVDKDSFYCSPFTISGSPLPYTFITVE
FT                   IKGPTQRFIKKKSIQIIKAESPVFVQTDKPIYKPGQIVKFRVVSVDISFRPLNETFPVV
FT                   YIETPKRNRIFQWQNIHLAGGLHQLSFPLSVEPALGIYKVVVQKDSGKKIEHSFEVKEY
FT                   VLPKFEVIIKMQKTMAFLEEELPITACGVYTYGKPVPGLVTLRVCRKYSRYRSTCHNQN
FT                   SMSICAEFSQQADDKGCFSQVVKTKVFQLSQKGHDMKIEVEAKIKEEGTGIELTGIGSC
FT                   EIANALSKLKFTKVNTNYRPGLPFSGQVLLVDEKGKPIPNKNITSVVSPLGYLSIFTTD
FT                   EHGLANISIDTSNFTAPFLRVVVTYKQNHVCYDNWWLDEFHTQADHSATLVFSPSQSYI
FT                   QLELVFGTLACGQTQEIRIHYLLNEDIMKNEKTLTFYYLIKARGSIGNLGSHVLSLEQG
FT                   NMKGVFSLPIQVEPGMAPEAQLLIYAILPNEELVADAQNFEIEKCFANKVNLSFPSAQS
FT                   LPASDTHLKVKAAPLSLCALTAVDQSVLLLKPEAKLSPQSIYNLLPGKTVQGAFFGVPV
FT                   YKDHENCISGEDITHNGIVYTPKHSLGDNDAHSIFQSVGINIFTNSKIHKPRFCQEFQH
FT                   YPAMGGVAPQALAVAASGPGSSFRAMGVPMMGLDYSDEINQVVEVRETVRKYFPETWIW
FT                   DLVPLDVSGDGELAVKVPDTITEWKASAFCLSGTTGLGSSSTISLQAFQPFFLELTLPY
FT                   SVVRGEAFTLKATVLNYMSHCIQIRVDLEISPDFLAVPVGGHENSHCICGNERKTVSWA
FT                   VTPKSLGEVNFTRTAEALESQELCGNKLTEVPALVHKDTVVKSVIVEPEGIEKEQTYNT
FT                   LLCPQDTELQDNSSLELPPNVVEGSARATHSVLGDILGSAMQNLQNLLQMPYGCGEQNM
FT                   VLFVPNIYVLNYLNETQQLTEAIKSKAINYLISGYQRQLNYQHSDGSYSTFGNHGGGNT
FT                   PGNTWLTAFVLKAFAQAQSHIFIEKTHITNAFNWLSMKQKENGCFQQSGYLLNNAMKGG
FT                   VDDEVTLSAYITIALLEMPLPVTHSAVRNALFCLETAWASISQSQESHVYTKALLAYAF
FT                   ALAGNKAKRSELLESLNKDAVKEEDSLHWQRPGDVQKVKALSFYQPRAPSAEVEMTAYV
FT                   LLAYLTSESSRPTRDLSSSDLSTASKIVKWISKQQNSDGGLLLTQDTVVALQALSKYGS
FT                   ATFTRSQKEVLVTSRSSGTFSKTFHVNSGNRLLLQEVRLPDLPGNYVTKGSGSGCVYLQ
FT                   TSLKYNILPVADGKAPFALQVNTLPLNFDKAEDHRTFQIRINVSYTGERPSSNMVIVDV
FT                   KMVSGFIPMKPSVKRLQDQPNIQRTEVNTNHVLIYIEKLTNQTLGFSFAVEQDIPVKNL
FT                   KPAPIKVYDYYETDEFTVEEYSAPFSDGSEQGNA"
FT   sig_peptide     50..121
FT   mat_peptide     122..4534
FT                   /product="alpha-2-macroglobulin"
FT   polyA_signal    4650..4655
XX
SQ   Sequence 4674 BP; 1332 A; 1156 C; 1059 G; 1127 T; 0 other;
     cagagttcgg gggctgaggg ctcagacgtt cttctctgcc ctctccacca tgaggagaaa        60
     ccagctgccc acaccagctt ttcttttact gttcctgctt cttcccagag atgccaccac       120
     agctactgca aaaccacaat atgtggtgct ggtcccgtca gaggtctatc aggagtccct       180
     gaaaaggcct tgtgtcagcc tcaaccatgt gaatgagact gtgatgctca gcttaactct       240
     agagtatgca atgcagcaaa cgaagctcct cacagaccag gctgtggata aggactcctt       300
     ctactgcagc cccttcacga tctcaggttc acctttaccc tacacattca ttactgtgga       360
     gataaaagga ccaacgcagc gcttcataaa gaagaagtca atacaaataa taaaagctga       420
     gagcccagtc tttgtccaga cagacaaacc catatacaaa ccaggacaga tagtgaaatt       480
     ccgagttgtt tctgtggaca tcagttttcg cccgttgaat gaaacgttcc ctgtcgttta       540
     tattgagact cccaagagga accgaatttt tcaatggcaa aatatccatc tggcaggagg       600
     actccaccag ctctctttcc cactgtctgt tgagccagct ctgggtatct acaaggttgt       660
     agtgcagaag gactcaggga agaaaataga acactccttt gaggtgaagg aatacgtttt       720
     acccaaattt gaggtgataa taaaaatgca gaagactatg gctttcctgg aagaggaact       780
     tcctataact gcttgtggcg tatacacata tggaaagcct gttcccggtc tggtgacatt       840
     gagagtgtgc agaaaatatt cacgataccg ctccacctgc cataaccaaa actcaatgag       900
     tatctgtgcc gaattcagcc aacaggcaga tgataaagga tgtttcagcc aagttgtaaa       960
     aaccaaagta ttccagctca gccaaaaagg ccacgacatg aagatagagg tggaagccaa      1020
     aatcaaagag gaaggcacag gcatagaact aactggtatt ggatcatgtg aaatagcaaa      1080
     tgccttaagc aaactgaaat ttactaaagt aaatacaaat tacaggcctg ggctaccttt      1140
     ctctggtcag gttcttcttg ttgatgagaa aggtaaacca atccccaaca aaaacataac      1200
     ttccgtcgtg tctccacttg ggtacctgtc catttttact acggatgagc atggcttggc      1260
     taacatttcc attgacactt ccaacttcac agctccgttt ttgagagttg tggtcaccta      1320
     caagcagaac catgtctgct atgataactg gtggcttgat gaatttcaca cacaggcaga      1380
     ccattctgca actctagtct tttctccaag ccagagttat atccaacttg aacttgtttt      1440
     tggtactttg gcctgtgggc aaactcagga gattcggata cactacctct tgaatgaaga      1500
     tatcatgaag aatgaaaaga ctttaacctt ttactatctg atcaaagcaa ggggaagcat      1560
     cggcaactta ggaagccatg tgttgtcgct tgaacaagga aacatgaaag gagtcttttc      1620
     cctcccaatt caagtggagc caggcatggc tcccgaggct cagctgctca tttatgctat      1680
     tttacctaat gaagaacttg tcgctgatgc tcagaatttt gaaatcgaga agtgttttgc      1740
     caacaaggta aatttgagtt tcccatcagc acagagcctg ccagcctctg acacccacct      1800
     gaaggtcaaa gccgcgcctc tgtccctctg tgccctcact gcagtagacc agagtgtgct      1860
     gctactgaag cccgaagcca agctctcacc tcagtcaatc tacaatttgc tgccaggaaa      1920
     gactgtccag ggtgccttct ttggtgtccc agtgtacaaa gaccatgaga actgcatcag      1980
     cggagaagac atcactcaca atgggatcgt gtacacgcca aagcactctc tgggcgataa      2040
     tgatgcacac agcatttttc agtctgtagg aataaatatt tttaccaact ccaaaatcca      2100
     caaaccacgc ttttgtcaag agtttcaaca ctatccggca atgggaggag tggcacctca      2160
     agccttagct gtggctgctt caggcccagg atccagcttc agagcaatgg gcgtgccgat      2220
     gatggggttg gactactctg atgaaattaa tcaggtggtg gaagtaagag agacagtgcg      2280
     gaagtacttc cctgagacct ggatctggga cctggtgcca ctggacgtat ccggggacgg      2340
     tgaattggcg gtaaaggtcc ccgacaccat cactgagtgg aaggccagtg cattctgctt      2400
     gtctggaacc actggccttg gctcttcctc caccatctcc cttcaagcct tccagccctt      2460
     cttcttggag ctcactctcc catactctgt ggtgcgaggg gaagccttta ccctcaaagc      2520
     caccgtgctc aattacatgt ctcactgcat tcagatccga gtggacctag agatttctcc      2580
     tgatttcctg gcagtcccag tggggggcca tgaaaactct cattgcatct gtggaaatga      2640
     aaggaaaacc gtgtcctggg ctgtgacccc aaagtcgctg ggggaggtga acttcacacg      2700
     taccgcagaa gccttggagt ctcaagaatt gtgtggcaat aagttgacag aagtgccagc      2760
     ccttgtacac aaggacactg tggtgaagtc cgtaatagtt gagcctgaag gaattgagaa      2820
     ggagcaaacg tacaacacac tgttatgccc acaagatact gagttacaag ataattcctc      2880
     actggagctt ccacccaatg tggttgaagg atctgccagg gctacacatt ccgttttggg      2940
     tgatatactg ggctctgcaa tgcaaaacct ccagaatctt ctccagatgc cctatggctg      3000
     tggggaacaa aacatggtcc tttttgtccc taacatctat gttctgaact atctgaacga      3060
     gacacagcag ctgacagagg cgatcaagtc caaagccatt aactacctca tcagtgggta      3120
     ccagaggcag ctgaactatc agcacagtga tggctcgtac agcacattcg ggaaccatgg      3180
     tggtggcaac actccgggaa atacttggct cactgcgttt gtgctcaagg cctttgctca      3240
     agctcagtcg cacatcttta tagagaagac acacatcaca aatgctttca actggctctc      3300
     catgaaacaa aaggagaatg gctgtttcca acagtctgga tatctgctta acaatgcgat      3360
     gaagggtggt gtggatgatg aagtgactct ctctgcctac atcaccattg ctctgctgga      3420
     gatgcctctg cctgtcacgc acagtgctgt gcgaaatgct ctattttgcc tggaaacggc      3480
     ctgggcctcc atctcacaga gccaggaaag tcatgtctat accaaggcat tgctggccta      3540
     tgcctttgcc ctggcaggaa acaaggcgaa gagaagcgaa ctgcttgaat ccctaaacaa      3600
     agatgctgtg aaggaagagg attcactgca ctggcaacgc cctggggatg ttcagaaagt      3660
     gaaggcctta tctttctatc aacctcgggc cccttctgcc gaagtggaga tgacagctta      3720
     cgtgcttctc gcctatctaa cctctgagtc ttcccggccc acacgggacc tgtcttcatc      3780
     agacctgtca acagcatcca agattgtgaa gtggatcagc aagcaacaaa actcggacgg      3840
     ggggcttctc ctgactcagg atacagtggt ggctctccaa gccctctcca aatatggatc      3900
     tgccactttt acgagaagtc agaaagaagt gttggtcaca tcgagatctt cagggacctt      3960
     ctctaagact ttccatgtta acagtgggaa tcgcctgctg ctgcaggaag tcaggctgcc      4020
     agatctgccc ggaaattacg tcaccaaagg gtcaggatca ggatgtgtgt accttcagac      4080
     atctctaaag tacaacatcc tcccagtggc agatggaaaa gcacccttcg ctctgcaagt      4140
     caacactctc ccactaaact ttgacaaggc agaggatcac agaacattcc agattcgcat      4200
     caacgtaagc tacactggag aacgacccag ctccaacatg gtcattgttg atgtgaagat      4260
     ggtatcaggc ttcataccta tgaagccatc cgtgaaaagg ctccaagacc agcctaacat      4320
     tcagaggact gaagtgaaca ccaaccatgt tctaatctac attgaaaagc taaccaatca      4380
     aaccctcggt ttctccttcg cggtggaaca agacatccca gtaaagaact taaaaccagc      4440
     ccccataaaa gtctatgatt attatgagac agatgaattc accgttgaag aatacagtgc      4500
     ccctttcagt gatggctctg aacaaggaaa tgcttaaaag tcggaaccta tagatgtcct      4560
     cagaaggact cctccacaca tgaagaacca agaagaaaga cagcaagata aacggaaggg      4620
     aattaaaaaa ccataacatt tatatgttga ataaagttat gacatttaaa aaaa            4674
//


spacer
spacer