Dbfetch

ID   M86568; SV 1; linear; mRNA; STD; MUS; 1700 BP.
XX
AC   M86568; M57521;
XX
DT   07-FEB-1992 (Rel. 30, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mouse GABA-A receptor alpha-3 subunit mRNA, complete cds.
XX
KW   GABA-alpha receptor alpha-3 subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1700
RX   PUBMED; 1356407.
RA   Wang J.B., Kofuji P., Fernando J.C.R., Moss S.J., Huganir R.L., Burt D.R.;
RT   "The alpha 1, alpha 2, and alpha 3 subunits of GABAA receptors: comparison
RT   in seizure-prone and -resistant mice and during development";
RL   J. Mol. Neurosci. 3(4):177-184(1992).
XX
DR   MD5; a5f0efaa0f838e6155fb56c4e133859b.
DR   Ensembl-Gn; ENSMUSG00000031343; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035793; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035777; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035699; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035764; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035467; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036294; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034759; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035442; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035595; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035546; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035684; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035581; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036315; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034459; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034901; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000055966; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096327; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096420; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0096358; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096344; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095894; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096850; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096485; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095811; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0096019; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095862; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0096048; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095828; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097197; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095902; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094871; mus_musculus_wsbeij.
DR   EuropePMC; PMC1414800; 16569693.
DR   RFAM; RF01803; GABA3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1700
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="C57BL/6J"
FT                   /strain="DBA/2J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     178..261
FT                   /gene="GABA-A receptor alpha-3 subunit"
FT   CDS             178..1656
FT                   /codon_start=1
FT                   /gene="GABA-A receptor alpha-3 subunit"
FT                   /product="GABA-A receptor alpha-3 subunit"
FT                   /db_xref="GOA:P26049"
FT                   /db_xref="InterPro:IPR001390"
FT                   /db_xref="InterPro:IPR005433"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26049"
FT                   /protein_id="AAA37651.1"
FT                   /translation="MIITQMWHFYVTRVVLLLLISILPGTTSQGESRRQEPGDFVKQDI
FT                   GGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGP
FT                   VSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHN
FT                   MTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTKAEVIYS
FT                   WTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQ
FT                   TYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDW
FT                   FIAVCYAFVFSALIEFATVNYFTKRSWAWEGKKVPEALEMKKKTPAAPTKKNTTFNIVG
FT                   TTYPINLAKDTEFSTISKSAAAPSASSTPTAIASPKATYVQDSPAETKTYNSVSKVDKI
FT                   SRIIFPVLFAIFNLVYWATYVNRESAIKGMIRKQ"
FT   mat_peptide     262..1653
FT                   /gene="GABA-A receptor alpha-3 subunit"
FT                   /product="GABA-A receptor alpha-3 subunit"
XX
SQ   Sequence 1700 BP; 483 A; 404 C; 369 G; 444 T; 0 other;
     ctagctagct agcaaagcag agagactgac tgagataggg actaggagaa atatctagag        60
     aaagaaaaga agccaggctc tatcagggct tagctccaac ttgtttctcc tctctgcttc       120
     ggggaagtga ctgtgacact cgatctcaca ggtctcttca agttgctgtc taagaagatg       180
     ataatcacac aaatgtggca cttttatgtg accagagttg tacttcttct cctgattagt       240
     attctccctg gaaccactag ccaaggggaa tcaagacgac aagaacctgg ggactttgtg       300
     aaacaagata ttggaggact ctctcccaag catgccccag atattcctga cgatagtaca       360
     gataatatca ctatcttcac tagaatcttg gatcggcttt tggatggcta tgataaccgg       420
     cttcgacctg gacttggaga tgcagtgact gaagtgaaga cagacatcta tgtgaccagt       480
     tttggccctg tgtcagacac tgatatggaa tatactattg atgtattttt tagacagaca       540
     tggcatgatg aaagactgaa atttgatgga ccaatgaaga tccttccact gaacaatctt       600
     ctggctagta agatatggac tcctgatacc ttcttccaca atggtaaaaa atcagtggct       660
     cacaatatga ccacacccaa caagctgctc agactggtag ataatgggac cctcctctat       720
     acaatgaggt taacaataca cgctgaatgc cccatgcatt tggaagattt ccccatggat       780
     gtgcatgcct gcccactgaa gtttggaagc tatgcctata ccaaagctga agtaatttat       840
     tcttggactc ttgggaagaa caaatctgtg gaagtagcac aggatggctc acgcctgaat       900
     cagtatgact tgcttggcca tgttgttggg acagagataa tccggtctag tacaggagaa       960
     tatgtcgtca tgacaaccca ctttcatctg aagagaaaaa ttggctactt tgtcatccag      1020
     acctacttgc catgtatcat gactgtcatt ctgtcacaag tgtctttctg gcttaataga      1080
     gaatctgtcc ctgcccgcac agtctttggt gtcaccactg ttctcaccat gaccaccttg      1140
     agtatcagtg ccagaaactc tttacctaaa gtggcatacg cgacggccat ggactggttc      1200
     atagccgtct gttatgcctt tgtattttca gcactgattg aatttgctac tgtcaactac      1260
     ttcaccaagc ggagttgggc ttgggaaggc aagaaggtac cagaggccct ggagatgaag      1320
     aagaaaacac cagcagctcc aacaaagaaa aacaccacct tcaacatagt gggtaccacc      1380
     tatcctatca atctggccaa ggatactgag ttctccacca tctccaagtc tgctgctgct      1440
     cccagtgctt cttcaactcc aacagcgatt gcttcaccca aggctactta tgtgcaagac      1500
     agtcctgctg agaccaagac ctacaacagt gtcagcaagg ttgacaaaat ttcccgcatc      1560
     atcttccctg tgctctttgc catattcaat cttgtctatt gggctacata tgtgaaccgg      1620
     gaatcagcta tcaagggcat gatccgcaaa cagtagataa tagtggcagc acagcttcca      1680
     gagcactgta taccccaggg                                                  1700
//