Dbfetch

ID   M83649; SV 1; linear; mRNA; STD; MUS; 1480 BP.
XX
AC   M83649;
XX
DT   19-MAR-1992 (Rel. 31, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus Fas antigen mRNA, complete cds.
XX
KW   Fas antigen; transmembrane protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1480
RX   PUBMED; 1371136.
RA   Watanabe-Fukunaga R., Brannan C.I., Itoh N., Yonehara S., Copeland N.G.,
RA   Jenkins N.A., Nagata S.;
RT   "The cDNA structure, expression, and chromosomal assignment of the mouse
RT   Fas antigen";
RL   J. Immunol. 148(4):1274-1279(1992).
XX
DR   MD5; 649b4f3caa683c70642bf04dcaf5e530.
DR   Ensembl-Gn; ENSMUSG00000024778; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025034; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025030; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024789; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024766; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024898; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024859; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024984; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024890; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025529; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024323; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025691; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0051587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0051530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051529; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051260; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051395; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0051307; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051262; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0051426; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050544; mus_musculus_wsbeij.
DR   EuropePMC; PMC1389803; 15973771.
DR   EuropePMC; PMC148819; 12595423.
DR   EuropePMC; PMC1592725; 16809779.
DR   EuropePMC; PMC2169347; 10579724.
DR   EuropePMC; PMC3300661.
DR   EuropePMC; PMC33252; 11320206.
DR   EuropePMC; PMC523004; 15501793.
DR   EuropePMC; PMC538991; 15618193.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1480
FT                   /organism="Mus musculus"
FT                   /map="Chromosome 19 (dista"
FT                   /mol_type="mRNA"
FT                   /cell_line="Bam3"
FT                   /tissue_lib="lambda gt11"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     50..112
FT                   /gene="Fas antigen"
FT   CDS             50..1033
FT                   /codon_start=1
FT                   /gene="Fas antigen"
FT                   /product="Fas antigen"
FT                   /note="NGF/TNF-receptor-related protein"
FT                   /db_xref="GOA:P25446"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR008063"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:95484"
FT                   /db_xref="PDB:2NA6"
FT                   /db_xref="PDB:3OQ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25446"
FT                   /protein_id="AAA37593.1"
FT                   /translation="MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVHETDKNCS
FT                   EGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCD
FT                   EEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRK
FT                   QSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLS
FT                   KYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSD
FT                   AYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE"
FT   mat_peptide     113..1030
FT                   /gene="Fas antigen"
FT                   /product="Fas antigen"
FT                   /note="NGF/TNF-receptor-related protein"
FT   misc_feature    113..556
FT                   /gene="Fas antigen"
FT                   /note="extracellular domain"
FT   misc_feature    557..607
FT                   /gene="Fas antigen"
FT                   /note="transmembrane domain[B"
FT   misc_feature    608..1030
FT                   /gene="Fas antigen"
FT                   /note="cytoplasmic domain"
FT   regulatory      1455..1460
FT                   /gene="Fas antigen"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1480 BP; 472 A; 309 C; 329 G; 370 T; 0 other;
     gccgcaggct gcccacacag gccgcccgct gttttccctt gctgcagaca tgctgtggat        60
     ctgggctgtc ctgcctctgg tgcttgctgg ctcacagtta agagttcata ctcaaggtac       120
     taatagcatc tccgagagtt taaagctgag gaggcgggtt catgaaactg ataaaaactg       180
     ctcagaagga ttatatcaag gaggcccatt ttgctgtcaa ccatgccaac ctggtaaaaa       240
     aaaagttgag gactgcaaaa tgaatggggg tacaccaacc tgtgccccat gcacagaagg       300
     gaaggagtac atggacaaga accattatgc tgataaatgc agaagatgca cactctgcga       360
     tgaagagcat ggtttagaag tggaaacaaa ctgcaccctg acccagaata ccaagtgcaa       420
     gtgcaaacca gacttctact gcgattctcc tggctgtgaa cactgtgttc gctgcgcctc       480
     gtgtgaacat ggaacccttg agccatgcac agcaaccagc aatacaaact gcaggaaaca       540
     aagtcccaga aatcgcctat ggttgttgac catccttgtt ttgttaattc cacttgtatt       600
     tatatatcga aagtaccgga aaagaaagtg ctggaaaagg agacaggatg accctgaatc       660
     tagaacctcc agtcgtgaaa ccataccaat gaatgcctca aatcttagct tgagtaaata       720
     catcccgaga attgctgaag acatgacaat ccaggaagct aaaaaatttg ctcgagaaaa       780
     taacatcaag gagggcaaga tagatgagat catgcatgac agcatccaag acacagctga       840
     gcagaaagtc cagctgctcc tgtgctggta ccaatctcat gggaagagtg atgcatatca       900
     agatttaatc aagggtctca aaaaagccga atgtcgcaga accttagata aatttcagga       960
     catggtccag aaggaccttg gaaaatcaac cccagacact ggaaatgaaa atgaaggaca      1020
     atgtctggag tgaaaactac ctcagttcca gccatgaaga gaggagagag cctgccaccc      1080
     atgatggaaa caaaatgaat gccaactgta ttgacattgg caactcctgg tgtgttctct      1140
     ttgccagcaa atggtagttg atactcagtg agggtcaaat gactagcagg ttccagggac      1200
     tgcttctgtt attctctgca gttgctgaga tgaaccattt tctctgtcta ctgcaatttt      1260
     tacattcaaa tgtccatgaa atttgtatta aatgtgaagt ggaatctgca gtgtttgtgt      1320
     ttatattcat atactatgaa ctgaggagaa ttataaactg aaacaaatac tcgcagttaa      1380
     ttgaagacct tccattgatg gacagttctt ttcctctcta tatggaaatg tataatagaa      1440
     gaaataattt ttaaattaaa gtatctcttt ttgcatttca                            1480
//