Dbfetch

ID   M81831; SV 1; linear; genomic DNA; STD; MUS; 1265 BP.
XX
AC   M81831;
XX
DT   03-FEB-1992 (Rel. 30, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Mus musculus somatostatin receptor isoform 1 gene, complete cds.
XX
KW   somatostatin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1265
RX   DOI; 10.1073/pnas.89.1.251.
RX   PUBMED; 1346068.
RA   Yamada Y., Post S.R., Wang K., Tager H.S., Bell G.I., Seino S.;
RT   "Cloning and functional characterization of a family of human and mouse
RT   somatostatin receptors expressed in brain, gastrointestinal tract, and
RT   kidney";
RL   Proc. Natl. Acad. Sci. U.S.A. 89(1):251-255(1992).
XX
DR   MD5; 4c7aaf0b3f205b27ce88ecbd6f2e8125.
DR   Ensembl-Gn; ENSMUSG00000035431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110671; mus_musculus.
XX
CC   genomic sequence; gene lacks introns.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1265
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             88..1263
FT                   /codon_start=1
FT                   /gene="somatostatin receptor"
FT                   /product="somatostatin receptor isoform 1"
FT                   /db_xref="GOA:P30873"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000586"
FT                   /db_xref="InterPro:IPR001116"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:98327"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30873"
FT                   /protein_id="AAA58255.1"
FT                   /translation="MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNA
FT                   SQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIAD
FT                   ELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPI
FT                   KAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVG
FT                   FVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFV
FT                   ICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCL
FT                   SWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCASRISTL"
XX
SQ   Sequence 1265 BP; 229 A; 379 C; 366 G; 291 T; 0 other;
     tggagccttg agcctaggga gggcgcagac agcaagggcg caaggtgagc gccccagccg        60
     gagccgcacc ggcccacttc agctgggatg ttccccaatg gcaccgcctc ctctccctcc       120
     tcttctccaa gccccagccc aggcagctgc ggggaaggag cctgcagcag gggtccgggg       180
     tccggcgctg cggacggcat ggaagagcct ggacgaaacg cttcccagaa tgggacctta       240
     agcgagggac agggtagcgc cattctcatc tctttcatct actccgtggt atgcttggtg       300
     ggactgtgtg ggaactctat ggtcatctat gtgatcctgc gctacgccaa gatgaagacc       360
     gctaccaaca tctacattct aaacctggct attgctgatg agctgctcat gctcagcgtg       420
     ccctttctgg tcacttccac gctgttgcgc cactggccct tcggcgcgct actttgccgc       480
     ctggtgctca gcgtggatgc ggtcaacatg ttcaccagca tctactgtct gactgtgctt       540
     agtgtggacc gctatgtggc tgtggtgcac ccgatcaagg cagcgcgcta ccgtcggccc       600
     actgtggcca aagtagtgaa cctgggcgtg tgggtcctgt cattactggt tatcttgccc       660
     atcgtggtct tctcacgcac cgcagccaac agcgatggca cggtagcctg caacatgctc       720
     atgcccgagc ccgcccagcg ctggttggtg ggcttcgtct tatacacatt tctcatgggc       780
     ttcctgctgc ctgtcggggc catttgcctg tgttatgtgc tcatcattgc caagatgcgc       840
     atggtggccc tcaaggctgg ctggcagcag cgcaagcgct cagagcgcaa gatcactcta       900
     atggtgatga tggtggtgat ggtttttgtc atctgctgga tgcctttcta cgtggtacag       960
     ctggtcaacg tgttcgccga gcaagacgac gccaccgtga gccagttgtc tgtcatcctg      1020
     ggctatgcca acagctgtgc caaccccata ctctacggct tcctgtcgga caacttcaag      1080
     cgctctttcc agcgcatcct gtgcctcagc tggatggata acgctgcgga ggaaccagtc      1140
     gactactatg ccactgccct gaagagtcga gcctacagcg tggaggactt ccagcccgag      1200
     aatctggagt ctggaggcgt tttccgtaat ggcacctgcg cttccaggat cagcacgctt      1260
     tgagg                                                                  1265
//