spacer

EBI Dbfetch

ID   M81591; SV 1; linear; mRNA; STD; MUS; 2253 BP.
XX
AC   M81591;
XX
DT   23-MAY-1992 (Rel. 31, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Murine CD10 neutral endopeptidase 24.11 (CD10/NEP) mRNA, putative cds.
XX
KW   CD10 neutral endopeptidase 24.11.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2253
RX   PUBMED; 1374101.
RA   Chen C.-Y., Salles G., Seldin M.F., Kister A.E., Reinher E.L., Shipp M.A.;
RT   "Murine common acute lymphoblastic leukemia antigen (CD10 neutral
RT   endopeptidase 24.11). Molecular characterization, chromosomal localization,
RT   and modeling of the active site";
RL   J. Immunol. 148(9):2817-2825(1992).
XX
DR   MD5; 01e7cbea9b879670e5e38541cf135199.
DR   Ensembl-Gn; ENSMUSG00000027820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029400; mus_musculus.
DR   EuropePMC; PMC96872; 10496897.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2253
FT                   /organism="Mus musculus"
FT                   /map="chromosome 3"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2253
FT                   /codon_start=1
FT                   /gene="CD10/NEP"
FT                   /product="CD10 neutral endopeptidase 24.11"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61391"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:97004"
FT                   /db_xref="PDB:2YVC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61391"
FT                   /protein_id="AAA37386.1"
FT                   /translation="MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLXTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   SNFDILRDELEVILKDVLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLKLLPD
FT                   IYGWPVASDNWDQTYGTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQP
FT                   RLGLPSRGYYECTGIYKEACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMELEK
FT                   EIANATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGKSFSWSNFTNEIMSTVNINIQN
FT                   EEEVVVYAPEYLTKLKPILTKYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW"
XX
SQ   Sequence 2253 BP; 729 A; 436 C; 500 G; 587 T; 1 other;
     atgggaagat cagaaagtca gatggatata actgatatca atgctccaaa gccaaagaag        60
     aaacagcgat ggactcccct ggagatcagc ctctctgtgc ttgtcttgct ccygactatc       120
     atagcggtga caatgatcgc tctctatgca acctatgatg atggcatttg caaatcatca       180
     gactgcataa aatcagctgc tcgactgatt cagaatatgg atgcctctgt tgagccatgt       240
     acagacttct tcaagtatgc ttgtggaggc tggttgaaac gcaacgtcat tcccgagacc       300
     agttcccgat acagtaattt tgacatttta agagatgagc tagaagtcat tttgaaagat       360
     gtccttcaag aacccaaaac tgaagacata gtagcagtgc agaaagcaaa aaccttgtac       420
     agatcgtgta taaatgagtc tgctattgat agcagaggcg gacaacctct actcaaactg       480
     ttaccagata tatatgggtg gccagtagca tcagataact gggatcaaac atatggcact       540
     tcttggacag ctgagaaatc cattgcacaa ctgaattcta aatatgggaa aaaggtcctc       600
     attaattttt ttgttggcac tgatgataag aattctaccc agcatataat tcattttgac       660
     cagcctcgac ttggcctccc ttccagaggc tactatgagt gcactggaat atataaagag       720
     gcttgcacag catatgtgga ttttatgatt tctgtggcca gactgattcg tcaggaacaa       780
     agtttgccta ttgatgaaaa ccagctctct ttggaaatga ataaagttat ggaattggaa       840
     aaagaaattg ccaatgctac aactaaacca gaagaccgaa atgacccaat gctgctttat       900
     aacaaaatga cattggccaa gctgcagaac aacttttccc tggaggtcaa tgggaagtca       960
     ttcagctggt caaatttcac aaatgaaatc atgtcaactg tgaatattaa tattcaaaat      1020
     gaggaagaag ttgttgtcta tgctccagaa tatttaacca aacttaagcc tattcttacc      1080
     aaatattctc ccagagatct tcaaaattta atgtcctgga ggttcataat ggatcttgta      1140
     agcagcctca gccgaaacta caaggagtcc agaaatgctt tccgcaaggc cctttatggg      1200
     actacatcag aaactgcaac atggagacgg tgtgctaact acgtcaatgg gaatatggag      1260
     aatgctgtgg ggaggctcta tgtggaagcg gcttttgctg gagagagcaa gcacgtggtt      1320
     gaagacttga ttgcacaaat ccgggaagtt tttattcaga ctttggatga ccttacttgg      1380
     atggatgctg agacaaaaaa gaaagctgaa gaaaaggcct tggcaattaa agaaaggatt      1440
     ggctatcctg atgacatcat ttccaatgag aacaaactga ataatgagta tcttgagttg      1500
     aactacaggg aagatgaata ctttgagaac ataattcaaa atttgaaatt cagccaaagc      1560
     aagcagctaa agaagctccg agaaaaagtg gacaaagatg agtggataag tggagcagct      1620
     gtagtcaatg cattttattc ctcaggccga aatcagatag tcttccccgc tggcattttg      1680
     cagcccccat tcttcagtgc tcagcaatcc aactcattga actatggggg catcggcatg      1740
     gtcattggac atgaaatcac acatggattt gatgacaatg gaagaaattt caataaagat      1800
     ggagacctcg ttgactggtg gacgcagcag tcggcaaata attttaaaga ccaatcccag      1860
     tgtatggtat accagtatgg aaacttttcc tgggacctag caggtggaca gcatctcaat      1920
     ggaattaata cactaggaga aaacattgct gataatggag gtattggcca agcatacaga      1980
     gcctatcaga attatgttaa aaagaatggt gaagaaaaat tactccctgg acttgacctc      2040
     aatcacaaac aactattttt cctgaacttt gcccaggtgt ggtgtgggac ctaccggcca      2100
     gagtatgcag tcaattctat taaaacagat gtacacagtc ctggaaattt caggatcatt      2160
     gggactttgc agaactctgc cgagtttgca gatgcctttc attgccgcaa gaattcatac      2220
     atgaatccag aaaggaaatg tcgggtttgg tga                                   2253
//


spacer
spacer