spacer

EBI Dbfetch

ID   M77673; SV 1; linear; genomic DNA; STD; HUM; 261 BP.
XX
AC   M77673;
XX
DT   27-FEB-1992 (Rel. 31, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens lymphocyte DNA (allele DRB1*1408), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-261
RX   DOI; 10.1007/BF00215663.
RX   PUBMED; 1644450.
RA   Gao X., Veale A., Serjeantson S.W.;
RT   "HLA class II diversity in Australian aborigines: unusual HLA-DRB1
RT   alleles";
RL   Immunogenetics 36(5):333-337(1992).
XX
DR   MD5; ff4d6db842d1d7da96146959221474d6.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..261
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..261
FT                   /partial
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAA73131.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVT
FT                   ELGRPDAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQR"
XX
SQ   Sequence 261 BP; 53 A; 61 C; 97 G; 50 T; 0 other;
     ttcttggagt actctacgtc tgagtgtcat ttcttcaatg ggacggagcg ggtgcggttc        60
     ctggacagat acttccataa ccaggaggag ttcgtgcgct tcgacagcga cgtgggggag       120
     taccgggcgg tgacggagct ggggcggcct gatgcggagc actggaacag ccagaaggac       180
     ctcctggagc ggaggcgggc cgaggtggac acctattgca gacacaacta cggggttgtg       240
     gagagcttca cagtgcagcg g                                                 261
//


spacer
spacer