spacer

EBI Dbfetch

ID   M65049; SV 1; linear; genomic DNA; STD; HUM; 173 BP.
XX
AC   M65049;
XX
DT   13-JUL-1991 (Rel. 28, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Human MHC HLA-DQB1 allele DBQ1.5 gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-173
RX   DOI; 10.1007/BF01719235.
RX   PUBMED; 2010218.
RA   Bugawan T.L., Erlich H.A.;
RT   "Rapid typing of HLA-DQB1 DNA polymorphism using nonradioactive
RT   oligonucleotide probes and amplified DNA";
RL   Immunogenetics 33(3):163-170(1991).
XX
DR   MD5; ee4701c889eae28071cdeceeffa4d463.
DR   Ensembl-Gn; ENSG00000179344; homo_sapiens.
DR   Ensembl-Tr; ENST00000374943; homo_sapiens.
DR   Ensembl-Tr; ENST00000399079; homo_sapiens.
DR   Ensembl-Tr; ENST00000399084; homo_sapiens.
DR   Ensembl-Tr; ENST00000434651; homo_sapiens.
DR   Ensembl-Tr; ENST00000484729; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..173
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..173
FT                   /partial
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="lymphocyte antigen"
FT                   /db_xref="GOA:O78224"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O78224"
FT                   /protein_id="AAA59709.1"
FT                   /translation="TERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQK
FT                   EVLEGTRAELDT"
XX
SQ   Sequence 173 BP; 36 A; 44 C; 69 G; 24 T; 0 other;
     ggacggagcg cgtgcgtctt gtgaccagat acatctataa ccgagaggag tacgcgcgct        60
     tcgacagcga cgtgggggtg taccgcgcgg tgacgccgca ggggcggcct gatgccgagt       120
     actggaacag ccagaaggaa gtcctggagg ggacccgggc ggagttggac acg              173
//


spacer
spacer