Dbfetch

ID   M63244; SV 1; linear; mRNA; STD; MUS; 1944 BP.
XX
AC   M63244;
XX
DT   15-MAR-1996 (Rel. 47, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus amino levulinate synthase mRNA, complete cds.
XX
KW   amino levulinate synthase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RA   Young E.G., Dierks P.M.;
RT   "Two genes encode Ala synthase in DBA/2 mouse: Housekeeping and
RT   erythroid-specific";
RL   Unpublished.
XX
DR   MD5; 634ece8aebda5aba71bb951cc59c4571.
DR   Ensembl-Gn; ENSMUSG00000025270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066337; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1944
FT                   /organism="Mus musculus"
FT                   /strain="DBA/2"
FT                   /mol_type="mRNA"
FT                   /dev_stage="Friend cell"
FT                   /cell_type="erythrocyte"
FT                   /tissue_type="erythroleukemic"
FT                   /db_xref="taxon:10090"
FT   misc_feature    1..52
FT                   /note="iron-response element"
FT   CDS             55..1818
FT                   /codon_start=1
FT                   /transl_except=(pos:1123..1125,aa:Asp)
FT                   /gene="ALAS-E"
FT                   /product="mino levulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /db_xref="GOA:P08680"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015118"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="MGI:MGI:87990"
FT                   /db_xref="PDB:1H7D"
FT                   /db_xref="PDB:1H7J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08680"
FT                   /protein_id="AAA91866.1"
FT                   /translation="MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQG
FT                   PTCSQIHLKATKAGGDSPSWAKSHCPFXLSELQDRKSKIVQRAAPEVQEDVKTFKTDLL
FT                   STMDSTTRSHSFPSFQEPEQTEGAVPHLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYR
FT                   VFKTVNRRANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAG
FT                   AGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSD
FT                   AGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAIVPL
FT                   EELCDVAHQYGALTFVDEVHAVGLYGAGVQVSGERDGIMHKLDIISGTLGKAFGCVGGY
FT                   IASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMR
FT                   QLLMDRGFPVIPCPSHIIPIWVGNAALNSKICDLLLSKHSIYVQAINYXTVPRGEELLX
FT                   XAPXPHHSPQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFG
FT                   NMGPQYVTTYA"
FT   polyA_site      1944
FT                   /gene="ALAS-E"
XX
SQ   Sequence 1944 BP; 449 A; 522 C; 494 G; 471 T; 8 other;
     actcaccgtc tttggttcgt cctcagtgca gggcaacagg actttgggct caggatggtg        60
     gcagcagcta tgttgctacg gtcctgtcca gtgctctctc agggccccac aggcctcctg       120
     ggcaaagtgg ctaaaaccta ccagttccta tttagtattg gacgctgccc catcctggcc       180
     actcaaggac caacctgttc tcaaatccat cttaaggcaa ccaaggctgg aggagactct       240
     ccatcttggg ctaagagcca ttgtcctttc atnctgtcag aactccaaga caggaagagc       300
     aagattgtgc agagggcagc tccagaagtt caagaggatg tcaagacttt caagacagac       360
     ctgctgagca ccatggattc aaccacccga agccattcat ttcctagttt ccaggagcca       420
     gagcagactg aaggggcagt tccccacctg attcagaaca atatgactgg aagccaggct       480
     ttcggttatg accaattttt cagagacaag atcatggaga agaaacagga ccacacctac       540
     cgtgtgttca agactgtgaa tcgaagggct aatgcctacc cctttgccca acacttctcc       600
     gaggcatcta tggcatcaaa ggatgtttct gtttggtgta gtaatgacta tttgggcata       660
     agcagacacc ctcgtgtctt gcaggccata gaggagacct tgaagaatca tggagctgga       720
     gctgggggca ctcgcaatat ctcaggtacc agcaagtttc atgtggagct tgaacaggag       780
     ctggctgaac tacaccagaa agactcagct ctgctcttct cctcctgttt tgtggccaat       840
     gattctactc tctttacact ggccaagctt ctgccagggt gtgagatcta ctcagatgca       900
     ggcaatcatg cctccatgat ccaaggcatt cgcaacagtg gtgcagccaa gtttgtcttc       960
     agacacaatg acccaggcca cctgaagaaa cttctcgaga agtctgatcc caagacacca      1020
     aaaattgtgg cttttgagac tgttcattcc atggatggtg ccatcgtgcc tctggaggaa      1080
     ttgtgtgatg tggcccacca gtatggagcc ctgaccttcg tataggaagt ccatgctgta      1140
     ggactgtatg gagccggggt gcaggtatcg ggggagcgtg atggaattat gcacaagctt      1200
     gacatcatct ctggaactct tggcaaggcc tttggttgcg tcggtggcta tatagccagc      1260
     actcgggact tggtggacat ggtgcgctcc tacgctgcag gcttcatctt taccacttca      1320
     ctgcctccca tggtgctctc tggggctcta gaatctgtgc gcctactcaa gggagaggag      1380
     ggtcaagccc tgaggcgggc acaccagcgc aatgtcaaac acatgcgcca gctgctaatg      1440
     gacaggggct ttcctgttat cccctgtccc agccacatca tccccatctg ggtgggtaat      1500
     gcagcactca acagcaagat ctgtgatctt ctgctctcca agcacagcat ctatgtgcag      1560
     gccatcaact acncaactgt gcctcgtggt gaggagctac tgnncntggc ccccnnnccc      1620
     caccacagcc ctcagatgat ggaaaacttt gtggagaagc tgctgctggc ctggactgag      1680
     gtggggctgc ccctccaaga tgtgtctgtg gctgcatgca acttctgtca tcgtcctgtg      1740
     cactttgaac ttatgagcga gtgggagcga tcctactttg ggaacatggg accccaatat      1800
     gttaccacct atgcttaagg agccagctgc cttggatgcc agctccacct gcactccccc      1860
     tgggctgggc ttcctcctgc tctctgcttt cctgtgtgct tctggctgac ttgattctga      1920
     aaataaagag caacttgaaa catt                                             1944
//