Dbfetch

ID   M59803; SV 1; linear; mRNA; STD; HUM; 304 BP.
XX
AC   M59803; M34324;
XX
DT   16-JAN-1991 (Rel. 26, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human MHC class II DRB1 mRNA (DRw13), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-304
RX   PUBMED; 2212675.
RA   Lee K.W., Johnson A.H., Hurley C.K.;
RT   "Two divergent routes of evolution gave rise to the DRw13 haplotypes";
RL   J. Immunol. 145(9):3119-3125(1990).
XX
DR   MD5; 31da4f85cd29fbc5ef1ad1da23a55c35.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..304
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="1125"
FT                   /isolate="1124"
FT                   /mol_type="mRNA"
FT                   /haplotype="DRw13"
FT                   /dev_stage="adult"
FT                   /clone="1125-14"
FT                   /clone="1124-57"
FT                   /cell_line="1125"
FT                   /cell_line="1124"
FT                   /cell_type="B lymphoblastoid"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>304
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC DR beta DRw13 variant"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAA64237.1"
FT                   /translation="GDTRPRFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVG
FT                   EFRAVTELGRPSAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVHPKVTV"
XX
SQ   Sequence 304 BP; 66 A; 74 C; 106 G; 58 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttctataacc aagaggagta cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctag cgccgagtac       180
     tggaacagcc agaaggacat cctggaagac gagcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccatcc taaggtgact       300
     gtgt                                                                    304
//