spacer

EBI Dbfetch

ID   M57973; SV 1; linear; mRNA; STD; MUS; 882 BP.
XX
AC   M57973; J05675;
XX
DT   12-JAN-1991 (Rel. 26, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Mouse L-type calcium channel (CaCh2a) mRNA, partial cds.
XX
KW   L-type calcium channel.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-882
RX   PUBMED; 2173707.
RA   Perez-Reyes E., Wei X.Y., Castellano A., Birnbaumer L.;
RT   "Molecular diversity of L-type calcium channels. Evidence for alternative
RT   splicing of the transcripts of three non-allelic genes";
RL   J Biol Chem 265(33):20430-20436(1990).
XX
DR   MD5; a224abe740642424a074f93de88cb0f0.
DR   Ensembl-Gn; ENSMUSG00000051331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112825; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..882
FT                   /organism="Mus musculus"
FT                   /strain="Outbred Swiss ICR"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /clone="MOV72"
FT                   /tissue_type="ovary"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>882
FT                   /codon_start=1
FT                   /gene="CaCh2a"
FT                   /product="cardiac L-type calcium channel"
FT                   /note="splice variant"
FT                   /db_xref="GOA:Q01815"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005446"
FT                   /db_xref="InterPro:IPR005451"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014873"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="MGI:MGI:103013"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01815"
FT                   /protein_id="AAA63291.1"
FT                   /translation="VGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKN
FT                   QHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVE
FT                   MILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRIS
FT                   ITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFG
FT                   KIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTE
FT                   GETPCGSSFAVFY"
FT   misc_difference 346..462
FT                   /gene="CaCh2a"
FT                   /note="different from other clones (e.g. mov74)."
XX
SQ   Sequence 882 BP; 204 A; 243 C; 216 G; 219 T; 0 other;
     gtgggtttcg tcattgtcac cttccaggag cagggggaac aagagtacaa gaactgtgag        60
     ctggacaaga accagagaca atgtgtggaa tatgccctca aggcccgacc cttgcgaagg       120
     tacatcccaa agaaccagca ccagtacaaa gtgtggtacg tggtcaactc tacctacttc       180
     gagtatctga tgttcgttct catcctgctc aacaccatct gcctggccat gcagcactat       240
     ggccagagct gcctcttcaa aatcgccatg aatatactca acatgctttt caccggcctc       300
     ttcacagtgg agatgatcct gaagctcatt gccttcaaac ccaagggtta ctttagtgat       360
     ccctggaatg tttttgactt cctcatcgtc attgggagca taattgatgt cattctcagt       420
     gagactaatc cagctgaaca tacccaatgc tctccctcta tgagtgcaga ggagaactcc       480
     cgcatctcca tcactttctt ccgcctcttc cgggtcatgc gcctggtgaa gctgctgagc       540
     cgcggggaag gcatccgaac cctgctgtgg accttcatca agtccttcca ggctctgccc       600
     tatgtggctc ttttgattgt gatgctgttc tttatctatg cagtgattgg gatgcaggtg       660
     tttgggaaga ttgccctgaa tgacaccaca gagatcaatc ggaacaacaa cttccagacg       720
     ttcccccagg ctgtgttact gctgttcagg tgtgccaccg gagaggcctg gcaggacatc       780
     atgctggcct gcatgccagg caagaagtgt gccccagagt ctgagcccag caacagcacg       840
     gaaggggaga ccccctgtgg cagcagcttt gctgtcttct ac                          882
//


spacer
spacer