spacer

EBI Dbfetch

ID   M36411; SV 1; linear; mRNA; STD; MUS; 1411 BP.
XX
AC   M36411;
XX
DT   30-AUG-1990 (Rel. 25, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mouse Mpv17 mRNA, complete cds.
XX
KW   Mpv17.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1411
RX   DOI; 10.1016/0092-8674(90)90008-3.
RX   PUBMED; 1696177.
RA   Weiher H., Noda T., Gray D.A., Sharpe A.H., Jaenisch R.;
RT   "Transgenic mouse model of kidney disease: insertional inactivation of
RT   ubiquitously expressed gene leads to nephrotic syndrome";
RL   Cell 62(3):425-434(1990).
XX
DR   MD5; ed9599d4ae60474ddcca60154f8c6f7c.
DR   Ensembl-Gn; ENSMUSG00000101678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154241; mus_musculus.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by T.Noda, 12-JUL-1990.
CC   The cDNA sequence is derived from Mpv17 locus of mice.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1411
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..1411
FT                   /note="Mpv17 mRNA"
FT   CDS             49..579
FT                   /codon_start=1
FT                   /note="Mpv17"
FT                   /db_xref="GOA:P19258"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="MGI:MGI:97138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19258"
FT                   /protein_id="AAA39736.1"
FT                   /translation="MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQ
FT                   HQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCF
FT                   LPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAI
FT                   VWNSYLSWKAHQF"
XX
SQ   Sequence 1411 BP; 363 A; 352 C; 351 G; 345 T; 0 other;
     cccagtcacc tgagagaagg ttctgcgcag agctggcact cagggagcat ggcactctgg        60
     cgagcatacc agagagccct ggcagcacat ccgtggaaag tccaggttct gacagctgga       120
     tcactgatgg gcgtaggtga catgatctca cagcagctgg tggagaggcg gggtctccag       180
     caacaccagg caggccgcac tctgaccatg gtatccctgg gctgtggctt tgtgggccct       240
     gtcgtcggag gctggtacaa agttttagac cacttaatcc cgggcaccac gaaggtgcat       300
     gcactgaaga agatgttgtt agatcagggg ggctttgccc catgtttcct aggctgcttt       360
     ctcccactgg tcgggatact caatggaatg tcagcccagg acaattgggc caaactgaag       420
     cgggactacc ctgatgccct catcaccaac tactatctct ggcctgctgt gcagttagcc       480
     aacttctacc tggtccccct gcattacagg ttggctgttg tccagtgtgt tgctattgtc       540
     tggaactcct acctatcctg gaaggcacat cagttctaag cgtgccttgt tccatggttt       600
     gcaccttgta ctgatgcacc gtgaccctgg aatgcttgga cagcttcttc aaactaacca       660
     catcaggact ggagcggtga ctcagctgtt agaagcacgg attatctgct ctacagagga       720
     cctaaatttg gttccaagca cccacatcgg gtggctcaca actccctatg tctcaagctc       780
     caggagatct gatgttctct tctggcctct gaagcacctg cacaaacatg tatataccca       840
     cgaatagaca cgcatttgta attaagcaca caatgaaatc tttaaaagga aggagtgtgt       900
     cagcttccat gctatggggt tgctgatcag aatagggtga ccactctgaa gtggcacatt       960
     tcactttaac cactaagaca tttataatat tgctgtcact ctggccctta gctgatgggg      1020
     acacactata agaattgtgt cctgggggct ggagagatgg ctcagcctgt aagagcactg      1080
     actgctcttc agaagctcct gagttcaaat cccagcaaca catggtggct cacaaccatc      1140
     tgtaaagaga tctgacgccc tcttctggag tgtctgaaga cagctacagt gtactcatat      1200
     ttaattaatt aattaataat taattaatta atatagaatt gtgtcctgga agccaggcat      1260
     ggtggtacat gccttcaatc ccagcacttg ggaggcagag gcaggcagat ttctgagttc      1320
     aaggtcagcc tagtctacag agtgagttcc aggacagcca gggctataca gagaaaccct      1380
     gtgtcaggaa aaaaaacaaa aaaacaaaac c                                     1411
//


spacer
spacer