spacer

EBI Dbfetch

ID   M35980; SV 1; linear; mRNA; STD; HUM; 157 BP.
XX
AC   M35980;
XX
DT   11-AUG-1990 (Rel. 25, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 5)
XX
DE   Human MHC class II HLA-DR-beta chain mRNA, 5' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-157
RX   DOI; 10.1111/j.1365-3083.1984.tb00904.x.
RX   PUBMED; 6422542.
RA   Gustafsson K., Wiman K., Larhammar D.G., Rask L., Peterson P.A.;
RT   "Signal sequences distinguish class II histocompatibility antigen beta
RT   chains of different loci";
RL   Scand. J. Immunol. 19(1):91-97(1984).
XX
DR   MD5; 9917b6171b1e6f24d585086fe09ee840.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..157
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     8..94
FT                   /note="MHC HLA-DR-beta chain signal peptide"
FT   CDS             8..>157
FT                   /codon_start=1
FT                   /note="MHC HLA-DR-beta chain precursor"
FT                   /db_xref="GOA:O19721"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19721"
FT                   /protein_id="AAA36286.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGT"
FT   mat_peptide     95..>157
FT                   /note="MHC HLA-DR-beta chain"
XX
SQ   Sequence 157 BP; 26 A; 42 C; 46 G; 43 T; 0 other;
     ctccagcatg gtgtgtctga ggctccctgg aggctcctgc atggcagttc tgacagtgac        60
     actgatggtg ctgagctccc cactggcttt ggctggggac accagaccac gtttcttgga       120
     gtactctacg tctgagtgtc atttcttcaa tgggacg                                157
//


spacer
spacer