spacer

EBI Dbfetch

ID   M35857; SV 1; linear; mRNA; STD; HUM; 1080 BP.
XX
AC   M35857;
XX
DT   20-DEC-1990 (Rel. 26, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 5)
XX
DE   Human tumor necrosis factor receptor protein (TNFR) mRNA, 3' end.
XX
KW   tumor necrosis factor receptor protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1080
RX   DOI; 10.1073/pnas.87.16.6151.
RX   PUBMED; 2166946.
RA   Heller R.A., Song K., Onasch M.A., Fischer W.H., Chang D., Ringold G.M.;
RT   "Complementary DNA cloning of a receptor for tumor necrosis factor and
RT   demonstration of a shed form of the receptor";
RL   Proc. Natl. Acad. Sci. U.S.A. 87(16):6151-6155(1990).
XX
DR   Ensembl-Gn; ENSG00000028137; homo_sapiens.
DR   Ensembl-Tr; ENST00000376259; homo_sapiens.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by R.A.Heller, 29-JUN-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1080
FT                   /organism="Homo sapiens"
FT                   /map="12p13"
FT                   /mol_type="mRNA"
FT                   /dev_stage="parent"
FT                   /clone="16"
FT                   /cell_line="UC/HeLa2-5"
FT                   /cell_type="B-cell"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..1041
FT                   /codon_start=1
FT                   /gene="TNFR1"
FT                   /note="tumor necrosis factor receptor protein (TNFR)"
FT                   /db_xref="GOA:P20333"
FT                   /db_xref="H-InvDB:HIT000195651.13"
FT                   /db_xref="HGNC:HGNC:11917"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020411"
FT                   /db_xref="PDB:1CA9"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20333"
FT                   /protein_id="AAA63262.1"
FT                   /translation="RICTCRPGWYCALSKQEGCRLCAPLPKCRPGFGVARPGTETSDVV
FT                   CKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASRDAVCTSTSPTRSMAPGAVHLPQP
FT                   VSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGV
FT                   VNCVIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASA
FT                   LDRRAPTRNQPQAPGVEASGAGEARTSTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQ
FT                   CSSQASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPD
FT                   AGMKPS"
XX
SQ   Sequence 1080 BP; 226 A; 351 C; 327 G; 176 T; 0 other;
     cgcatctgca cctgcaggcc cggctggtac tgcgcgctga gcaagcagga ggggtgccgg        60
     ctgtgcgcgc cgctgccgaa gtgccgcccg ggcttcggcg tggccagacc aggaactgaa       120
     acatcagacg tggtgtgcaa gccctgtgcc ccggggacgt tctccaacac gacttcatcc       180
     acggatattt gcaggcccca ccagatctgt aacgtggtgg ccatccctgg gaatgcaagc       240
     agggatgcag tctgcacgtc cacgtccccc acccggagta tggccccagg ggcagtacac       300
     ttaccccagc cagtgtccac acgatcccaa cacacgcagc caactccaga acccagcact       360
     gctccaagca cctccttcct gctcccaatg ggccccagcc ccccagctga agggagcact       420
     ggcgacttcg ctcttccagt tggactgatt gtgggtgtga cagccttggg tctactaata       480
     ataggagtgg tgaactgtgt catcatgacc caggtgaaaa agaagccctt gtgcctgcag       540
     agagaagcca aggtgcctca cttgcctgcc gataaggccc ggggtacaca gggccccgag       600
     cagcagcacc tgctgatcac agcgccgagc tccagcagca gctccctgga gagctcggcc       660
     agtgcgttgg acagaagggc gcccactcgg aaccagccac aggcaccagg cgtggaggcc       720
     agtggggccg gggaggcgag gaccagcacc gggagctcag attcttcccc tggtggccat       780
     gggacccagg tcaatgtcac ctgcatcgtg aacgtctgta gcagctctga ccacagctca       840
     cagtgctcct cccaagccag ctccacaatg ggagacacag attccagccc ctcggagtcc       900
     ccgaaggacg agcaggtccc cttctccaag gaggaatgtg cctttcggtc acagctggag       960
     acgccagaga ccctgctggg gagcaccgaa gagaagcccc tgccccttgg agtgcctgat      1020
     gctgggatga agcccagtta accaggccgg tgtgggctgt gtcgtagcca aggtgggctg      1080
//


spacer
spacer