Dbfetch

ID   M35001; SV 1; linear; genomic DNA; STD; HUM; 357 BP.
XX
AC   M35001;
XX
DT   22-APR-1993 (Rel. 35, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Human MHC cell surface glycoprotein (HLA-DRB3) gene, exon 2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-357
RX   DOI; 10.1016/0198-8859(88)90034-1.
RX   PUBMED; 3372263.
RA   Horn G.T., Bugawan T.L., Long C.M., Manos M.M., Erlich H.A.;
RT   "Sequence analysis of HLA class II genes from insulin-dependent diabetic
RT   individuals";
RL   Hum. Immunol. 21(4):249-263(1988).
XX
DR   MD5; c4ccedd09513d9b1507caa9bc0968b77.
DR   EuropePMC; PMC40472; 8524834.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..357
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DR3"
FT                   /tissue_lib="lambda gt10 MCC of D. Buck"
FT                   /db_xref="taxon:9606"
FT   intron          <1..20
FT                   /gene="HLA-DRB3"
FT                   /number=1
FT                   /note="G00-120-644"
FT   exon            21..289
FT                   /gene="HLA-DRB3"
FT                   /number=2
FT                   /note="G00-120-644"
FT   CDS             <21..>289
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /product="cell surface glycoprotein"
FT                   /db_xref="GOA:Q9UM29"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UM29"
FT                   /protein_id="AAA53101.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   intron          290..>357
FT                   /gene="HLA-DRB3"
FT                   /number=2
FT                   /note="G00-120-644"
XX
SQ   Sequence 357 BP; 69 A; 84 C; 134 G; 70 T; 0 other;
     gatcgttcgt gtccccacag cacgtttctt ggagtactct acgtctgagt gtcatttctt        60
     caatgggacg gagcgggtgc ggtacctgga cagatacttc cataaccagg aggagaacgt       120
     gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg gagctggggc ggcctgatgc       180
     cgagtactgg aacagccaga aggacctcct ggagcagaag cggggccggg tggacaacta       240
     ctgcagacac aactacgggg ttgtggagag cttcacagtg cagcggcgag gtgagcgcgg       300
     cgcggcgggg cctggagtcc ctgtgagctg ggaatctgag tgtgtgtgtg tgtgtca          357
//