Dbfetch

ID   M33212; SV 1; linear; mRNA; STD; MUS; 1260 BP.
XX
AC   M33212;
XX
DT   12-JUL-1990 (Rel. 24, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mouse nucleolar protein N038 mRNA, complete cds.
XX
KW   nucleolar protein N038.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1260
RX   DOI; 10.1007/BF00303035.
RX   PUBMED; 3219912.
RA   Schmidt-Zachmann M.S., Franke W.W.;
RT   "DNA cloning and amino acid sequence determination of a major constituent
RT   protein of mammalian nucleoli. Correspondence of the nucleoplasmin-related
RT   protein NO38 to mammalian protein B23";
RL   Chromosoma 96(6):417-426(1988).
XX
DR   MD5; d1ef422f8a5f0284d09c6c4bc13a0580.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018141; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018114; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018078; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018083; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018537; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017460; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017869; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017979; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_LPJ_G0018051; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017997; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018576; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017241; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017509; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028501; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0028468; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0028428; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028447; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028947; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027895; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0028169; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0028303; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_LPJ_T0028414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0028269; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027602; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027748; mus_musculus_wsbeij.
DR   EuropePMC; PMC16192; 10716735.
DR   EuropePMC; PMC18509; 10811900.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1260
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="F9"
FT                   /cell_type="stem cell"
FT                   /tissue_type="teratocarcinoma"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..1260
FT                   /gene="N038"
FT                   /product="nucleolar protein"
FT   CDS             79..957
FT                   /codon_start=1
FT                   /gene="N038"
FT                   /product="nucleolar protein"
FT                   /db_xref="GOA:Q61937"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="InterPro:IPR032569"
FT                   /db_xref="InterPro:IPR036824"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="PDB:4N8M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61937"
FT                   /protein_id="AAA39801.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
XX
SQ   Sequence 1260 BP; 419 A; 214 C; 306 G; 321 T; 0 other;
     ggcgcgtctg ttctgtggaa caggaggcag ttgttttccg tccggcttct cccacaccga        60
     agtgcgcgcc tccacctcat ggaagactcg atggatatgg acatgagtcc tcttaggcct       120
     cagaactacc ttttcggctg tgaactaaag gctgacaaag actatcactt taaagtggat       180
     aatgatgaaa atgagcacca gttgtcatta agaacggtca gtttaggagc aggggcaaaa       240
     gatgagttac acatcgtaga ggcagaagca atgaactatg aaggcagtcc aattaaagta       300
     acactggcaa ctttgaaaat gtctgtacaa ccaacagttt ccctaggggg ctttgaaatt       360
     acaccacctg tggtcttacg gttgaagtgt ggttcagggc ctgtgcacat tagtggacag       420
     catctagtag ctgtagagga agatgcagag tctgaagatg aagatgagga ggacgtaaaa       480
     ctcttaggca tgtctggaaa gcgatctgct cctggaggtg gtaacaaggt tccacagaaa       540
     aaagtaaaac ttgatgaaga tgatgaggac gatgatgagg acgatgagga tgatgaggat       600
     gatgatgatg atgattttga tgaagaggaa actgaagaaa aggtcccagt gaagaaatct       660
     gtacgagata ccccagccaa aaatgcacaa aaatcaaacc aaaatggaaa agacttaaaa       720
     ccatcaacac cgagatcaaa gggtcaagag tccttcaaaa aacaggaaaa gactcctaaa       780
     acaccaaaag gacctagttc tgtagaagac attaaggcaa aaatgcaagc aagtatagaa       840
     aaaggcggtt ctcttcccaa agtggaagcc aagttcatta attatgtgaa gaattgtttc       900
     cggatgactg accaggaggc tattcaagat ctctggcagt ggaggaaatc tctttaagaa       960
     aagggtttaa acagtttgaa atattctgtc ttcatttctg taatagttaa tatctggctg      1020
     tcctttttat aatgcaaagt gagaactttc cctactgtgt ttgataaatg ttgtccaggt      1080
     tcacttgcca agaatgtgtt gtctaaaatg cctgtttagt tttcaaggat ggaactccac      1140
     cctttacttg gttttaagta tgtatggaat gttatgatag gacatagtaa tagtggtcag      1200
     atgtggaaat ggtagggaga caaatataca tgtgaaataa actcagtatt ttaataaagt      1260
//